(data stored in ACNUC7421 zone)

EMBL: CP000386.PE23

CP000386.PE23        Location/Qualifiers
FT   CDS             complement(25183..26472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0023"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: mbo:Mb0017c probable
FT                   cell division protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03004"
FT                   /db_xref="GOA:Q1B024"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B024"
FT                   /protein_id="ABG03004.1"
FT                   /translation="MTQRATMPMILALLVSTLGFATLIFVQEATSPPLVYGAYYAGTLF
FT                   ALYLAVRLLLPHSDVLLLPIVTLLTGLGLVMIFRLTYDVEGVENLAITQAVWILIGSAA
FT                   LLFIVLFFRNYERLFDYKYLFALAAVVLICLTFTPLGYEVNGARLWVRIGPVNFQPSEF
FT                   ARIALIIFYAGYLAEKRDLLAATSRSVLGVQIPSPKYFGPVALVWAVSLGLLVFERDLG
FT                   SSLLFFAVPLLMLYVATGRLAYVIIGGLMFSGGAFATYLLFDHVRVRVQTWLDPWQNPD
FT                   AEGFQILQSIFNIADGGITGTGLGAGFAQTIPEVHTDFIFSAIASELGLLGATAVLLAF
FT                   LVFVYRGIKISLLAGDEASKLLAYGLTAMFALQTLIIVGGVTRLIPLTGITLPFVSYGG
FT                   SSVVGNFILTGLLLVVSEKAGRRELGKEAR"
     MTQRATMPMI LALLVSTLGF ATLIFVQEAT SPPLVYGAYY AGTLFALYLA VRLLLPHSDV        60
     LLLPIVTLLT GLGLVMIFRL TYDVEGVENL AITQAVWILI GSAALLFIVL FFRNYERLFD       120
     YKYLFALAAV VLICLTFTPL GYEVNGARLW VRIGPVNFQP SEFARIALII FYAGYLAEKR       180
     DLLAATSRSV LGVQIPSPKY FGPVALVWAV SLGLLVFERD LGSSLLFFAV PLLMLYVATG       240
     RLAYVIIGGL MFSGGAFATY LLFDHVRVRV QTWLDPWQNP DAEGFQILQS IFNIADGGIT       300
     GTGLGAGFAQ TIPEVHTDFI FSAIASELGL LGATAVLLAF LVFVYRGIKI SLLAGDEASK       360
     LLAYGLTAMF ALQTLIIVGG VTRLIPLTGI TLPFVSYGGS SVVGNFILTG LLLVVSEKAG       420
     RRELGKEAR                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page