(data stored in ACNUC7421 zone)

EMBL: CP000386.PE230

CP000386.PE230       Location/Qualifiers
FT   CDS             238976..239635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0233"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH GntR-like; KEGG:
FT                   reu:Reut_B5875 regulatory protein GntR, HTH:GntR,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03211"
FT                   /db_xref="GOA:Q1AZG7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG7"
FT                   /protein_id="ABG03211.1"
FT                   /translation="MEDLSRPSFAQKIARVLADEIVERRLPPGRKLREQALAERFGTSR
FT                   APIREALYLLGQEGLVERTPRRGAVVKRYSPREVEEVYRIRLTLEEMALRRACDGLGMV
FT                   RRAVAALEPILEDMEASRKDARRYHELNVLFHRTLVEVSGSPVLPPVYTQIEGPLRMFL
FT                   RLSVMSREDVEKSIGDHRRILEAIAGGDAERAARILGAHELDGMNRALEAMREEDR"
     MEDLSRPSFA QKIARVLADE IVERRLPPGR KLREQALAER FGTSRAPIRE ALYLLGQEGL        60
     VERTPRRGAV VKRYSPREVE EVYRIRLTLE EMALRRACDG LGMVRRAVAA LEPILEDMEA       120
     SRKDARRYHE LNVLFHRTLV EVSGSPVLPP VYTQIEGPLR MFLRLSVMSR EDVEKSIGDH       180
     RRILEAIAGG DAERAARILG AHELDGMNRA LEAMREEDR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page