(data stored in ACNUC7421 zone)

EMBL: CP000386.PE231

CP000386.PE231       Location/Qualifiers
FT   CDS             complement(239690..241042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0234"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter major
FT                   facilitator superfamily MFS_1; KEGG: ypm:YP3897 putative
FT                   metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03212"
FT                   /db_xref="GOA:Q1AZG6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG6"
FT                   /protein_id="ABG03212.1"
FT                   /translation="MADQRTVAIASTEPREITARRAVRAACFGFFVDMFDVYLPIAALA
FT                   PAIVYFVPPGLSPEVESTIFFLIFAVTLIGRPVGAIIFGHFGDTIGRRRTTLISVAGFT
FT                   IITLLIALLPGYATWGMGAVALLILLRFLDGLCIGGEYTAANPLAMEYSPKERRGLYGS
FT                   LIHVGYPAALLAISALTALLTSIMPSGSPSSAYSVWGWRIPFFIGVILSAALFVYYLRK
FT                   VPESDLWQSAPKTGAPLKELLKGSNLRRMAQLFVVMSGAWLTLNATVGALPGVGNVLEA
FT                   NSGAVNTGTLIAAAIAVFLYPMLGLLSQRWGRRPTITLIGVLNAFPAAILYIMLVSFGT
FT                   LSNTIFVVLVAAVSLLGLLIWAVHTPYLVESFKTSVRSAGYGIAYSLATIIPGFYSFYL
FT                   LGLSKLMPYAYTPIVLLVLGGLFLSVGALLGPETKDVEFSPIEGDETRSQT"
     MADQRTVAIA STEPREITAR RAVRAACFGF FVDMFDVYLP IAALAPAIVY FVPPGLSPEV        60
     ESTIFFLIFA VTLIGRPVGA IIFGHFGDTI GRRRTTLISV AGFTIITLLI ALLPGYATWG       120
     MGAVALLILL RFLDGLCIGG EYTAANPLAM EYSPKERRGL YGSLIHVGYP AALLAISALT       180
     ALLTSIMPSG SPSSAYSVWG WRIPFFIGVI LSAALFVYYL RKVPESDLWQ SAPKTGAPLK       240
     ELLKGSNLRR MAQLFVVMSG AWLTLNATVG ALPGVGNVLE ANSGAVNTGT LIAAAIAVFL       300
     YPMLGLLSQR WGRRPTITLI GVLNAFPAAI LYIMLVSFGT LSNTIFVVLV AAVSLLGLLI       360
     WAVHTPYLVE SFKTSVRSAG YGIAYSLATI IPGFYSFYLL GLSKLMPYAY TPIVLLVLGG       420
     LFLSVGALLG PETKDVEFSP IEGDETRSQT                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page