(data stored in ACNUC7421 zone)

EMBL: CP000386.PE233

CP000386.PE233       Location/Qualifiers
FT   CDS             complement(242203..243711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0236"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: sma:SAV5722
FT                   putative acetyl CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03214"
FT                   /db_xref="GOA:Q1AZG4"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG4"
FT                   /protein_id="ABG03214.1"
FT                   /translation="MRRGERFYRFRAKKRGGGRALPGGGRGVASPAAREAIGAVATGFR
FT                   EFGEELVSGDPLGWPGYPEKLARVRERTGEGESVVVGEAQVGKTPVVVVAFDFRFLGGS
FT                   VGEAAGRRIVEAFERARESRRAVVSLVATGGSRMQEGMRSLVQLQRIADACVRAREEGI
FT                   PHISVLRGPVTGGIWASLGSSADYIIGVRGAEVAFAGSRVRGEEATEGEAFTAAGKLRS
FT                   GFVDAEAEPGEVPGLLRSAVELLRPAGGEPPAPPEVPRALGFARPPRDPWVAVMRARSP
FT                   RRPRAEAYLEDYFERRVEISGDRAGGVDAGMLCGFGRRRGRTIAYAAQNGTANTAAGFR
FT                   TARRLLELADRLQLPVLTLIDTPGAGNTAKDEREGVGTAIAELFCTVAGLKVPITSLVI
FT                   GEGGSGGALALAAPDNLWVTPDAYFAVISPEGAAAIVEKDRSRARQVAGRMKLMPQDLV
FT                   ELGVVRGIARPKRRPARAIRTSYDAVRRWVVRGHSSGKEHVTKS"
     MRRGERFYRF RAKKRGGGRA LPGGGRGVAS PAAREAIGAV ATGFREFGEE LVSGDPLGWP        60
     GYPEKLARVR ERTGEGESVV VGEAQVGKTP VVVVAFDFRF LGGSVGEAAG RRIVEAFERA       120
     RESRRAVVSL VATGGSRMQE GMRSLVQLQR IADACVRARE EGIPHISVLR GPVTGGIWAS       180
     LGSSADYIIG VRGAEVAFAG SRVRGEEATE GEAFTAAGKL RSGFVDAEAE PGEVPGLLRS       240
     AVELLRPAGG EPPAPPEVPR ALGFARPPRD PWVAVMRARS PRRPRAEAYL EDYFERRVEI       300
     SGDRAGGVDA GMLCGFGRRR GRTIAYAAQN GTANTAAGFR TARRLLELAD RLQLPVLTLI       360
     DTPGAGNTAK DEREGVGTAI AELFCTVAGL KVPITSLVIG EGGSGGALAL AAPDNLWVTP       420
     DAYFAVISPE GAAAIVEKDR SRARQVAGRM KLMPQDLVEL GVVRGIARPK RRPARAIRTS       480
     YDAVRRWVVR GHSSGKEHVT KS                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page