(data stored in ACNUC7421 zone)

EMBL: CP000386.PE235

CP000386.PE235       Location/Qualifiers
FT   CDS             complement(246483..247112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0239"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="PFAM: glutathione S-transferase-like; KEGG:
FT                   pae:PA2813 probable glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03216"
FT                   /db_xref="GOA:Q1AZG2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZG2"
FT                   /protein_id="ABG03216.1"
FT                   /translation="MREMLRVWGRDNSINVQKVLWCCGELGLEHERVDAGGAYGFPEGY
FT                   EEINPNRLVPAIEEDGFVLWESNAIVRYLAARYGAGTLWPEDTRARARADRWMDWQATA
FT                   LWEHLRPVFWGLVRTPPEERDEAAIEEARRKTAGAWAILERHLEGREEYVEGDALTMAD
FT                   IPLGVSARRWFGLDIERPPMPNLEAWYGRLLEREAFRDCVAGIPLT"
     MREMLRVWGR DNSINVQKVL WCCGELGLEH ERVDAGGAYG FPEGYEEINP NRLVPAIEED        60
     GFVLWESNAI VRYLAARYGA GTLWPEDTRA RARADRWMDW QATALWEHLR PVFWGLVRTP       120
     PEERDEAAIE EARRKTAGAW AILERHLEGR EEYVEGDALT MADIPLGVSA RRWFGLDIER       180
     PPMPNLEAWY GRLLEREAFR DCVAGIPLT                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page