(data stored in ACNUC7421 zone)

EMBL: CP000386.PE238

CP000386.PE238       Location/Qualifiers
FT   CDS             248891..249364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0242"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO1139 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03219"
FT                   /db_xref="GOA:Q1AZF9"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF9"
FT                   /protein_id="ABG03219.1"
FT                   /translation="MRGLGGAAPDLVGGLLLAALGAALAAGATGYGVTTAEGRLGPGFM
FT                   PFAVGLLLALFGGLVCVQALWGGRGSGEAGESAGGRSVAAVFALTLLAILLTPVIGFLP
FT                   AFGLLVFALARFVEGEGWVAAALLGTGGAAAAWAVFVLFLQIPLPGGVFVAGG"
     MRGLGGAAPD LVGGLLLAAL GAALAAGATG YGVTTAEGRL GPGFMPFAVG LLLALFGGLV        60
     CVQALWGGRG SGEAGESAGG RSVAAVFALT LLAILLTPVI GFLPAFGLLV FALARFVEGE       120
     GWVAAALLGT GGAAAAWAVF VLFLQIPLPG GVFVAGG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page