(data stored in ACNUC7421 zone)

EMBL: CP000386.PE239

CP000386.PE239       Location/Qualifiers
FT   CDS             249368..250894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0243"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: bja:bll0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03220"
FT                   /db_xref="GOA:Q1AZF8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF8"
FT                   /protein_id="ABG03220.1"
FT                   /translation="MELLDQILLGFQTALSPVNLAYCFVGVVLGTVIGLLPGLGSATGV
FT                   ALLLPLTLTLEPVTALIMLAGIYYGTQYGATISSVLIATPGDSATVVTTIEGYRLARRG
FT                   RAGPALAVAAIASFLAGTISIVLLMTLAPVFASFALDFGPPEMAALMVLGLAGVIGFTG
FT                   SSRAKGLAMAAFGLALATVGIDPSTGVERFTFGNVQLLGGIGFLEVVIGLFAVAEVMSA
FT                   VRRGGGEPIRTRFRDMLLSREDWRRSRGAIARGGLLGFFLGVLPGAGATLASFFAYDVE
FT                   RRLSRRRDEFGKGAIEGVAGPEAANNAAVNGAFVPTLTLGIPGSGTTAVLLGAFLLFGI
FT                   QPGPLLLEEQPQLVWGLIASFYIGNLLLLLLNLPLAPLFASILRLRYGLLYPLILLLCF
FT                   VGAYAVENRMWGVWIAFAFGVIGYFMKRYGYPAAPVVLGLILGPMLEKALMQTSSMGGG
FT                   DFGIFLQRPIALALFAVAALVVVGPLLARGAGLLLAGRPGSAHGREQKGG"
     MELLDQILLG FQTALSPVNL AYCFVGVVLG TVIGLLPGLG SATGVALLLP LTLTLEPVTA        60
     LIMLAGIYYG TQYGATISSV LIATPGDSAT VVTTIEGYRL ARRGRAGPAL AVAAIASFLA       120
     GTISIVLLMT LAPVFASFAL DFGPPEMAAL MVLGLAGVIG FTGSSRAKGL AMAAFGLALA       180
     TVGIDPSTGV ERFTFGNVQL LGGIGFLEVV IGLFAVAEVM SAVRRGGGEP IRTRFRDMLL       240
     SREDWRRSRG AIARGGLLGF FLGVLPGAGA TLASFFAYDV ERRLSRRRDE FGKGAIEGVA       300
     GPEAANNAAV NGAFVPTLTL GIPGSGTTAV LLGAFLLFGI QPGPLLLEEQ PQLVWGLIAS       360
     FYIGNLLLLL LNLPLAPLFA SILRLRYGLL YPLILLLCFV GAYAVENRMW GVWIAFAFGV       420
     IGYFMKRYGY PAAPVVLGLI LGPMLEKALM QTSSMGGGDF GIFLQRPIAL ALFAVAALVV       480
     VGPLLARGAG LLLAGRPGSA HGREQKGG                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page