(data stored in ACNUC7421 zone)

EMBL: CP000386.PE243

CP000386.PE243       Location/Qualifiers
FT   CDS             253411..254559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0247"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bur:Bcep18194_A4039 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03224"
FT                   /db_xref="GOA:Q1AZF4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF4"
FT                   /protein_id="ABG03224.1"
FT                   /translation="MSAGGPLSGILVVDLTRALAGPYATMMLADAGAEVVKVERPGTGD
FT                   DTRGWGPPFVGGPGEEESTYFLSVNRSKKSVVLDLKEPGDLERLKGLIRRADVLAENFR
FT                   PGVMERLGLGPEDLERLNPRLVSLSITGFGEGGPEGHRPGFDQIAQGEGGLMSFTGPVG
FT                   GPPTKVGVPIADILAGMFGAFGVVAALHERERSGRGQRVTSSLLGAIVGIHAFQGTRWL
FT                   IAGEVPRPEGNRHPTIAPYGAYECADGMINIAVGSEGLWRRFAPLVGLDPEDGRFDTNK
FT                   KRVSRVEELEEAMAPALRSAGVEEWMRRLGEAGVPAGRVLSLDEVYASPQVEHLGLVDA
FT                   VEHPRLGEIRLPGWPVGWSRSGRRRPEPPPTLGQHGGEVLGG"
     MSAGGPLSGI LVVDLTRALA GPYATMMLAD AGAEVVKVER PGTGDDTRGW GPPFVGGPGE        60
     EESTYFLSVN RSKKSVVLDL KEPGDLERLK GLIRRADVLA ENFRPGVMER LGLGPEDLER       120
     LNPRLVSLSI TGFGEGGPEG HRPGFDQIAQ GEGGLMSFTG PVGGPPTKVG VPIADILAGM       180
     FGAFGVVAAL HERERSGRGQ RVTSSLLGAI VGIHAFQGTR WLIAGEVPRP EGNRHPTIAP       240
     YGAYECADGM INIAVGSEGL WRRFAPLVGL DPEDGRFDTN KKRVSRVEEL EEAMAPALRS       300
     AGVEEWMRRL GEAGVPAGRV LSLDEVYASP QVEHLGLVDA VEHPRLGEIR LPGWPVGWSR       360
     SGRRRPEPPP TLGQHGGEVL GG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page