(data stored in ACNUC7421 zone)

EMBL: CP000386.PE244

CP000386.PE244       Location/Qualifiers
FT   CDS             254588..255352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0248"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   tfu:Tfu_3084 conserved hypothetical membrane permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03225"
FT                   /db_xref="GOA:Q1AZF3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZF3"
FT                   /protein_id="ABG03225.1"
FT                   /translation="MDPTHLLILGAAGLFGGILSGLFGVGGGGVFVPALVYGAGWNIKE
FT                   AVAASLVIIVFSALSGTVRSMRSESPVNWRVAALFSCTVAPSALIGVFVSRFSPDDVVE
FT                   LVFGCFLLSLAYPTFRRGSGRGGRRSLPPALALLGGVGVGTLSGLIGIGGAAMMVPLMM
FT                   LGFGVSPKSAISTSLAITVLLGSVGAAGYILTGFDRLGGLPPLIACAMAGAWLGVRLRD
FT                   RLSEGFLQRAFAAFMVVVAVRVLYDALSGLLA"
     MDPTHLLILG AAGLFGGILS GLFGVGGGGV FVPALVYGAG WNIKEAVAAS LVIIVFSALS        60
     GTVRSMRSES PVNWRVAALF SCTVAPSALI GVFVSRFSPD DVVELVFGCF LLSLAYPTFR       120
     RGSGRGGRRS LPPALALLGG VGVGTLSGLI GIGGAAMMVP LMMLGFGVSP KSAISTSLAI       180
     TVLLGSVGAA GYILTGFDRL GGLPPLIACA MAGAWLGVRL RDRLSEGFLQ RAFAAFMVVV       240
     AVRVLYDALS GLLA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page