(data stored in ACNUC7421 zone)

EMBL: CP000386.PE249

CP000386.PE249       Location/Qualifiers
FT   CDS             259502..259987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0253"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bld:BLi00693 phosphoribosylaminoimidazole
FT                   carboxylase I; RBL03724; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03230"
FT                   /db_xref="GOA:Q1AZE8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE8"
FT                   /protein_id="ABG03230.1"
FT                   /translation="MAARVGVIMGSASDWETMRHACEVLEELGVPHEKRVVSAHRTPDL
FT                   MFEYASGAAERGIGVIIAGAGGAAHLPGMVASKTVLPVIGVPVKSSSLNGLDSLLSIVQ
FT                   MPGGVPVATVAIGRAGATNAGLLAAQILAVRDPELRRRLEERRERMRRSVLEGGDLS"
     MAARVGVIMG SASDWETMRH ACEVLEELGV PHEKRVVSAH RTPDLMFEYA SGAAERGIGV        60
     IIAGAGGAAH LPGMVASKTV LPVIGVPVKS SSLNGLDSLL SIVQMPGGVP VATVAIGRAG       120
     ATNAGLLAAQ ILAVRDPELR RRLEERRERM RRSVLEGGDL S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page