(data stored in ACNUC7421 zone)

EMBL: CP000386.PE253

CP000386.PE253       Location/Qualifiers
FT   CDS             complement(263671..264666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0257"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: chy:CHY_2152
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03234"
FT                   /db_xref="GOA:Q1AZE4"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE4"
FT                   /protein_id="ABG03234.1"
FT                   /translation="MKRPVYIFNAGELQRQQNTLRFTLADGKRRFVPVETTGEIHVFGE
FT                   VSVNTKLLVFLAQNAIPLHVYNYYGYWSGSYMPREQYVSGYLTLKQAEHYLDHEMRLVL
FT                   ARAFVRGAMENMERVLGYYARRGVELDGQLAEIAGKKESLPLALTTEELMAVEGGCRDL
FT                   YYGCWDGIVKSEEFRFEKRTRRPPANRINALVSFGNSLLYVTVLSEIHRTHLDPRIGFL
FT                   HTTNQRRYTLNLDVAEVFKPIIVDRVIFSLLNRGAIQAKHFHKGTEGVFLNESGRKTFI
FT                   EAYETRLKETIKHPKLGRPVSYRRLIRMELYKLEKHLMGDEPYEPFVSRW"
     MKRPVYIFNA GELQRQQNTL RFTLADGKRR FVPVETTGEI HVFGEVSVNT KLLVFLAQNA        60
     IPLHVYNYYG YWSGSYMPRE QYVSGYLTLK QAEHYLDHEM RLVLARAFVR GAMENMERVL       120
     GYYARRGVEL DGQLAEIAGK KESLPLALTT EELMAVEGGC RDLYYGCWDG IVKSEEFRFE       180
     KRTRRPPANR INALVSFGNS LLYVTVLSEI HRTHLDPRIG FLHTTNQRRY TLNLDVAEVF       240
     KPIIVDRVIF SLLNRGAIQA KHFHKGTEGV FLNESGRKTF IEAYETRLKE TIKHPKLGRP       300
     VSYRRLIRME LYKLEKHLMG DEPYEPFVSR W                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page