(data stored in ACNUC7421 zone)

EMBL: CP000386.PE254

CP000386.PE254       Location/Qualifiers
FT   CDS             complement(264673..265794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0258"
FT                   /product="CRISPR-associated protein APE2256"
FT                   /note="TIGRFAM: CRISPR-associated protein APE2256; KEGG:
FT                   chy:CHY_2123 putative CRISPR-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03235"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE3"
FT                   /protein_id="ABG03235.1"
FT                   /translation="MPEREKSRLVLTTCGTSILTNDVDQERRRMINRLANHKEDELTPE
FT                   ERERLDRHIEERWQLLVDASLEQVKRMSAELNGLINYYGGNLTPRPGRPDEHILLTSDT
FT                   YLGRRVGDVLKEWLEERGFNVQVWCPGGLATKSREDFRRAMAELIRRCEGALPFRRDAG
FT                   YHVAFNLTGGFKSVQGFMQVVGMFYADEMFYIFETGSSLITIPRLPIRLETEAIVRDHE
FT                   QPFRRLGNGEVLPVEECREIPEDLLFEVDSDATLSEWGELIWQRGEKALYSEKLLEPLP
FT                   GLRYSPNFRKKVQRLKLSPDRLATLNERLDSLSLTVRGKKPNLSGLDFKQLRSNPKPPS
FT                   THECDVWSDDERRLFGHYEGSTFIVDDIERGLH"
     MPEREKSRLV LTTCGTSILT NDVDQERRRM INRLANHKED ELTPEERERL DRHIEERWQL        60
     LVDASLEQVK RMSAELNGLI NYYGGNLTPR PGRPDEHILL TSDTYLGRRV GDVLKEWLEE       120
     RGFNVQVWCP GGLATKSRED FRRAMAELIR RCEGALPFRR DAGYHVAFNL TGGFKSVQGF       180
     MQVVGMFYAD EMFYIFETGS SLITIPRLPI RLETEAIVRD HEQPFRRLGN GEVLPVEECR       240
     EIPEDLLFEV DSDATLSEWG ELIWQRGEKA LYSEKLLEPL PGLRYSPNFR KKVQRLKLSP       300
     DRLATLNERL DSLSLTVRGK KPNLSGLDFK QLRSNPKPPS THECDVWSDD ERRLFGHYEG       360
     STFIVDDIER GLH                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page