(data stored in ACNUC7421 zone)

EMBL: CP000386.PE255

CP000386.PE255       Location/Qualifiers
FT   CDS             complement(265787..267004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0259"
FT                   /product="CRISPR-associated protein, Cmr6 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1791; PFAM:
FT                   protein of unknown function DUF324; KEGG: tma:TM1791
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03236"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE2"
FT                   /protein_id="ABG03236.1"
FT                   /translation="MMLPLYKKAGEAKLEGAGNAGLWYDKFCNKWRREPAKHGNKEAWT
FT                   LEAFNQDGKTVNPKLAWIKTVTGGRVGDRRQLEEASGRIFDLLESRGGHPLFYRLESDF
FT                   VSGLGREHPVENGFAWHPTLGTPYLPGSSVKGLVRAWAEQWADPKPPKEDIKRIFGSES
FT                   KDDRDFRVGSVVFLDALPAEPVRLKADVMTPHYAPYYQGEEPPADWHSPNPIPFLVVAQ
FT                   GASFVFGVLPRRAGHAGDCDTVRGWLKEALEWIGAGAKTAVGYGRFAVDVKAQKRLERE
FT                   RKERKARQRELEEEERRKREVEEQARGKSPLYREILQASSEEKWREDKGAFAREGVAEG
FT                   WMDRIEADPQQDAVELFDGFMRQHYGDVLKDPDAKKGKKGRLKHKPRPRELAKRWLRIL
FT                   QEQKDA"
     MMLPLYKKAG EAKLEGAGNA GLWYDKFCNK WRREPAKHGN KEAWTLEAFN QDGKTVNPKL        60
     AWIKTVTGGR VGDRRQLEEA SGRIFDLLES RGGHPLFYRL ESDFVSGLGR EHPVENGFAW       120
     HPTLGTPYLP GSSVKGLVRA WAEQWADPKP PKEDIKRIFG SESKDDRDFR VGSVVFLDAL       180
     PAEPVRLKAD VMTPHYAPYY QGEEPPADWH SPNPIPFLVV AQGASFVFGV LPRRAGHAGD       240
     CDTVRGWLKE ALEWIGAGAK TAVGYGRFAV DVKAQKRLER ERKERKARQR ELEEEERRKR       300
     EVEEQARGKS PLYREILQAS SEEKWREDKG AFAREGVAEG WMDRIEADPQ QDAVELFDGF       360
     MRQHYGDVLK DPDAKKGKKG RLKHKPRPRE LAKRWLRILQ EQKDA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page