(data stored in ACNUC7421 zone)

EMBL: CP000386.PE256

CP000386.PE256       Location/Qualifiers
FT   CDS             complement(267001..267426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0260"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1791.1; KEGG:
FT                   afu:AF1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03237"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZE1"
FT                   /protein_id="ABG03237.1"
FT                   /translation="MAEERTLEQRRAAHALAAIQELQRAGRGGYGNYKSYVSSLPATIL
FT                   TNGLGQAAATLLAGAKLNSKNRNADNRAREKLYDHLSSWLCGGDEESPYQKKGDLLENI
FT                   TRNDQDCYIRAQAEALEYLSWLKRFAEAFLEGSKGEK"
     MAEERTLEQR RAAHALAAIQ ELQRAGRGGY GNYKSYVSSL PATILTNGLG QAAATLLAGA        60
     KLNSKNRNAD NRAREKLYDH LSSWLCGGDE ESPYQKKGDL LENITRNDQD CYIRAQAEAL       120
     EYLSWLKRFA EAFLEGSKGE K                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page