(data stored in ACNUC7421 zone)

EMBL: CP000386.PE258

CP000386.PE258       Location/Qualifiers
FT   CDS             complement(268235..269317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tth:TT_P0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03239"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD9"
FT                   /protein_id="ABG03239.1"
FT                   /translation="MKYYGIEALDTLFFGDGSPFDAGETGQIEVTGVFPPSPTTVVGAL
FT                   RAAFARELGWRCGDWPENVKAKLGDGQRLGPLRFAGPYVTRGGEPLFPAPLYLMKSGER
FT                   FTTRLRPRDTPLETDMGEVRLPEVVPVEDDSGKEAKGFKPLADAYLTKSGTERALRWEL
FT                   PQEEEVVKVSDLWEGEGRLGIRRDPEKRTTQEDALYLASHVRPRRGVALAMGVAGYEGP
FT                   APGLMTLGGESRMAYLEPCEISLPEAPELEPDGGRLRYTVTLLTPMRPQDEGWQRPGGG
FT                   LAGLPGEVVSACVGKPVLIGGWDTERKRPLDLEPHLPAGSTWFMETEAGEVDRVLEMHA
FT                   GHIGAKTEWGYGQILIGRWR"
     MKYYGIEALD TLFFGDGSPF DAGETGQIEV TGVFPPSPTT VVGALRAAFA RELGWRCGDW        60
     PENVKAKLGD GQRLGPLRFA GPYVTRGGEP LFPAPLYLMK SGERFTTRLR PRDTPLETDM       120
     GEVRLPEVVP VEDDSGKEAK GFKPLADAYL TKSGTERALR WELPQEEEVV KVSDLWEGEG       180
     RLGIRRDPEK RTTQEDALYL ASHVRPRRGV ALAMGVAGYE GPAPGLMTLG GESRMAYLEP       240
     CEISLPEAPE LEPDGGRLRY TVTLLTPMRP QDEGWQRPGG GLAGLPGEVV SACVGKPVLI       300
     GGWDTERKRP LDLEPHLPAG STWFMETEAG EVDRVLEMHA GHIGAKTEWG YGQILIGRWR       360
//

If you have problems or comments...

PBIL Back to PBIL home page