(data stored in ACNUC7421 zone)

EMBL: CP000386.PE259

CP000386.PE259       Location/Qualifiers
FT   CDS             complement(269314..271203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0263"
FT                   /product="CRISPR-associated protein, Cmr2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Crm2; KEGG:
FT                   tte:TTE2639 predicted hydrolase of the HD superfamily
FT                   (permuted catalytic motifs)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03240"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD8"
FT                   /protein_id="ABG03240.1"
FT                   /translation="MKKQSLHFTLGPVQGFVGQARRTRDLWAGSFLLSYLAGQAMKAVL
FT                   EGGGEIVFPEIGTRERPTDPLLAAILKRPISENPRPEIGSLPNRFKAGVQDGFDPERCE
FT                   EAVREAWKRIASSVWERYVEPVAAYGKGTKEIWERQVEGFWEMSWVIGEDPGDRSDQRW
FT                   LDLRKNWRTHHPPSEPGDKCTLMGSWQELSGYVRAREREAQDRFWDELRKKAGTLNLGE
FT                   HERLCAIALIKRLFPEVAKETIGWELNARTWPSTPYMAAVPWIEEARNKPEAKKHLELV
FT                   RSSGARSSAFGEYNTNLACPKNEKDFARLDGNFFHRAALENERATPDLSPQERKGLLEN
FT                   LKALNEAVGHPASTFYALLLMDGDRLGSLLQNKDIEPELISRALAEFTAEVEGIIGDHC
FT                   GRTVYAGGDDVLALLPVDRALQAAAELRCRFRRAFGSVFGDRRPVDKDGKTLKTTISAG
FT                   LVYATYNTPLRAVMQEAHRLLDEVAKDENGRDSIAASVLAGSGRTVQWVSAWDEGPGDE
FT                   QMITSTLTGLAEDLEEEFAGRFFYNVRERFDVLTGDGDRLIEDLDAQALLVAEYLKSRE
FT                   RDGDRREAEKTIERLLKVCRRRKGGEAPDEGTLDVSGAMLVRFLATKGRGVER"
     MKKQSLHFTL GPVQGFVGQA RRTRDLWAGS FLLSYLAGQA MKAVLEGGGE IVFPEIGTRE        60
     RPTDPLLAAI LKRPISENPR PEIGSLPNRF KAGVQDGFDP ERCEEAVREA WKRIASSVWE       120
     RYVEPVAAYG KGTKEIWERQ VEGFWEMSWV IGEDPGDRSD QRWLDLRKNW RTHHPPSEPG       180
     DKCTLMGSWQ ELSGYVRARE REAQDRFWDE LRKKAGTLNL GEHERLCAIA LIKRLFPEVA       240
     KETIGWELNA RTWPSTPYMA AVPWIEEARN KPEAKKHLEL VRSSGARSSA FGEYNTNLAC       300
     PKNEKDFARL DGNFFHRAAL ENERATPDLS PQERKGLLEN LKALNEAVGH PASTFYALLL       360
     MDGDRLGSLL QNKDIEPELI SRALAEFTAE VEGIIGDHCG RTVYAGGDDV LALLPVDRAL       420
     QAAAELRCRF RRAFGSVFGD RRPVDKDGKT LKTTISAGLV YATYNTPLRA VMQEAHRLLD       480
     EVAKDENGRD SIAASVLAGS GRTVQWVSAW DEGPGDEQMI TSTLTGLAED LEEEFAGRFF       540
     YNVRERFDVL TGDGDRLIED LDAQALLVAE YLKSRERDGD RREAEKTIER LLKVCRRRKG       600
     GEAPDEGTLD VSGAMLVRFL ATKGRGVER                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page