(data stored in ACNUC7421 zone)

EMBL: CP000386.PE262

CP000386.PE262       Location/Qualifiers
FT   CDS             complement(274071..274559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0266"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; PFAM:
FT                   protein of unknown function DUF83; KEGG: tte:TTE2659 RecB
FT                   family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03243"
FT                   /db_xref="GOA:Q1AZD5"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZD5"
FT                   /protein_id="ABG03243.1"
FT                   /translation="MITGTLVWYHAICPRQAWLMAHQMEPEREFELLAEGRLNQQEHYE
FT                   RSMKELSLPGMRLDRVRREGGRIIVSEVKKSTRYLPAARLQLGYYLLRLREEGVEASGE
FT                   ILVPKERFREGVELTQELEESVRDVLGELEGLLERSLPPPAARIPYCRKCAYAEFCWS"
     MITGTLVWYH AICPRQAWLM AHQMEPEREF ELLAEGRLNQ QEHYERSMKE LSLPGMRLDR        60
     VRREGGRIIV SEVKKSTRYL PAARLQLGYY LLRLREEGVE ASGEILVPKE RFREGVELTQ       120
     ELEESVRDVL GELEGLLERS LPPPAARIPY CRKCAYAEFC WS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page