(data stored in ACNUC7421 zone)

EMBL: CP000386.PE269

CP000386.PE269       Location/Qualifiers
FT   CDS             complement(282524..284209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03250"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC8"
FT                   /protein_id="ABG03250.1"
FT                   /translation="MNRLLSILDRIDRRGYGAYKDLQGSYDLGAFTLFVDRVQRDPFAP
FT                   PSLVRVRTKSNRFPSGLYGNPVRRVAFEDFLTRAVEAAVRRVVRGNRGSGGSGRVEIQH
FT                   PSQAVLPRTSMVVTGDYVEARMAVGLPARGRTVDARAARAVLLEELPEVVRRSLVPGGI
FT                   DEGAARRHVETVEDARHLRGLLPELGLVAFVADGAILPRESGASDRPLRQAAVPFQSPE
FT                   ELRVTVELPNRGELSGMGIPEGVTLVAGGGFHGKSTLLEALSRSVYDHIPGDGRELVVT
FT                   REDAVKIRAEDGRSVAGVDISGMIGDLPGGRSTSDFSTPNASGSTSQAANIAEALEIGT
FT                   SLLLVDEDTSATNFMIRDERMRELVRKEPISPFIDLVRPLHATLGVSTIVVVGGVGDYL
FT                   DVADRVILMEDYRPSDATPRAVEVRRKFPPRAPLGEARVRPPEDRRLRSSSIDLRRGKR
FT                   ETARGKGLSTIELGRERVDLTYLEQLVEPGQTEAIARIVGDFVAGTGSRGVRSVVEKAL
FT                   ASIERDGLDSLGSFRGHPGQMSLPRAHEVAGAINRIRSLEASTG"
     MNRLLSILDR IDRRGYGAYK DLQGSYDLGA FTLFVDRVQR DPFAPPSLVR VRTKSNRFPS        60
     GLYGNPVRRV AFEDFLTRAV EAAVRRVVRG NRGSGGSGRV EIQHPSQAVL PRTSMVVTGD       120
     YVEARMAVGL PARGRTVDAR AARAVLLEEL PEVVRRSLVP GGIDEGAARR HVETVEDARH       180
     LRGLLPELGL VAFVADGAIL PRESGASDRP LRQAAVPFQS PEELRVTVEL PNRGELSGMG       240
     IPEGVTLVAG GGFHGKSTLL EALSRSVYDH IPGDGRELVV TREDAVKIRA EDGRSVAGVD       300
     ISGMIGDLPG GRSTSDFSTP NASGSTSQAA NIAEALEIGT SLLLVDEDTS ATNFMIRDER       360
     MRELVRKEPI SPFIDLVRPL HATLGVSTIV VVGGVGDYLD VADRVILMED YRPSDATPRA       420
     VEVRRKFPPR APLGEARVRP PEDRRLRSSS IDLRRGKRET ARGKGLSTIE LGRERVDLTY       480
     LEQLVEPGQT EAIARIVGDF VAGTGSRGVR SVVEKALASI ERDGLDSLGS FRGHPGQMSL       540
     PRAHEVAGAI NRIRSLEAST G                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page