(data stored in ACNUC7421 zone)

EMBL: CP000386.PE27

CP000386.PE27        Location/Qualifiers
FT   CDS             complement(28951..30540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0027"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: Tyrosine protein kinase
FT                   Serine/threonine protein kinase; KEGG: nfa:nfa31920
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03008"
FT                   /db_xref="GOA:Q1B020"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B020"
FT                   /protein_id="ABG03008.1"
FT                   /translation="MAETRYIEGQERYVLAEMVGRGGFATVWRARPANGSPFGRREDVA
FT                   IKVIPVYSAAERSRALREGQIAEGLRHPNIVETIEVIPGEHEVYLVTEFVHGMPLDEAA
FT                   RYYGPAEIVDALAQILEALDYAHSQGIIHRDIKPQNALVDRSGLVKLTDFGVAYRAGDT
FT                   RLTRVGFAVGTPGYIAPEILDGADPSALTDIYAVGATARTLLSRLPDEPPPQLQEFVNR
FT                   ATSPNPAHRPQSAREALRLLTGRRATSPSVRVPSRARLRGRERLPAPLVERGLRATNGA
FT                   LAAGLGYLLAGDLLLLNGAQALSVAAGLGVAGYLLPRLAALGVIVALAVALLQGGTGLG
FT                   LAALVPAAGGLWAAGAGYLLRGADRLPLGPALAIPAALAGLGAGFPLLIGALMRPVAAA
FT                   LSSAAGALLLILYELTLGDGVIPFVGGPFRKMPPDIGPGELLGWMERVLTLYPETLYLG
FT                   LVWAASAAAVSLGERAGRPFLGLGAAAGGGALGYALAVCDTPSLRVDAVISLLLAAIMY
FT                   AVLRYLVARARG"
     MAETRYIEGQ ERYVLAEMVG RGGFATVWRA RPANGSPFGR REDVAIKVIP VYSAAERSRA        60
     LREGQIAEGL RHPNIVETIE VIPGEHEVYL VTEFVHGMPL DEAARYYGPA EIVDALAQIL       120
     EALDYAHSQG IIHRDIKPQN ALVDRSGLVK LTDFGVAYRA GDTRLTRVGF AVGTPGYIAP       180
     EILDGADPSA LTDIYAVGAT ARTLLSRLPD EPPPQLQEFV NRATSPNPAH RPQSAREALR       240
     LLTGRRATSP SVRVPSRARL RGRERLPAPL VERGLRATNG ALAAGLGYLL AGDLLLLNGA       300
     QALSVAAGLG VAGYLLPRLA ALGVIVALAV ALLQGGTGLG LAALVPAAGG LWAAGAGYLL       360
     RGADRLPLGP ALAIPAALAG LGAGFPLLIG ALMRPVAAAL SSAAGALLLI LYELTLGDGV       420
     IPFVGGPFRK MPPDIGPGEL LGWMERVLTL YPETLYLGLV WAASAAAVSL GERAGRPFLG       480
     LGAAAGGGAL GYALAVCDTP SLRVDAVISL LLAAIMYAVL RYLVARARG                   529
//

If you have problems or comments...

PBIL Back to PBIL home page