(data stored in ACNUC7421 zone)

EMBL: CP000386.PE275

CP000386.PE275       Location/Qualifiers
FT   CDS             complement(289269..289859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0280"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sth:STH2911
FT                   TetR family transcriptional regulator?"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03256"
FT                   /db_xref="GOA:Q1AZC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC2"
FT                   /protein_id="ABG03256.1"
FT                   /translation="MPRVVDHERRRVQIAEAAWRVIEREGPDKANLREIAREAGYTTGV
FT                   ITHYFSNKQQLMAFAFELLARRQVERMARSAERRDLTDALAQFLPLDEERRRETSVWLA
FT                   LLGASLKDPDFAAELRWRYQRMREAAWPLFKEALEEGNPDIETAADELLAIVDGITVDA
FT                   LIDPERYTPERQLSLLRRSLERLGIRLGPQPHG"
     MPRVVDHERR RVQIAEAAWR VIEREGPDKA NLREIAREAG YTTGVITHYF SNKQQLMAFA        60
     FELLARRQVE RMARSAERRD LTDALAQFLP LDEERRRETS VWLALLGASL KDPDFAAELR       120
     WRYQRMREAA WPLFKEALEE GNPDIETAAD ELLAIVDGIT VDALIDPERY TPERQLSLLR       180
     RSLERLGIRL GPQPHG                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page