(data stored in ACNUC7421 zone)

EMBL: CP000386.PE277

CP000386.PE277       Location/Qualifiers
FT   CDS             290468..291385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0282"
FT                   /product="luciferase-like protein"
FT                   /note="PFAM: luciferase-like; KEGG: nfa:nfa10300 putative
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03258"
FT                   /db_xref="GOA:Q1AZC0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZC0"
FT                   /protein_id="ABG03258.1"
FT                   /translation="MLEVAIMIEGQDGIDWPRWKRIVRTVEDAGYAALHRSDHFTNPSG
FT                   PVKDALELWASLTWLAENTERIEFGPLVTPVSFRHPVITAWQAAAVDGLSGGRLRLGLG
FT                   AGWQEREHTAFGFELLDAERRFARFEEGLEVVTRLLRSAEPVSFEGEFYRLRGAVLLPR
FT                   PARPGGVPVVVGGNGPRRTLPLAARYADEWNGLFLDAKRFAGLSARLDEMVEEAGRRPE
FT                   EVRRSLMVRAVFGRTEARVREKLGGAPRGALEEQAAIVGTAGEFVERLGELQEAGAQRV
FT                   MLQWLETDDLEGIEELASGVLPQL"
     MLEVAIMIEG QDGIDWPRWK RIVRTVEDAG YAALHRSDHF TNPSGPVKDA LELWASLTWL        60
     AENTERIEFG PLVTPVSFRH PVITAWQAAA VDGLSGGRLR LGLGAGWQER EHTAFGFELL       120
     DAERRFARFE EGLEVVTRLL RSAEPVSFEG EFYRLRGAVL LPRPARPGGV PVVVGGNGPR       180
     RTLPLAARYA DEWNGLFLDA KRFAGLSARL DEMVEEAGRR PEEVRRSLMV RAVFGRTEAR       240
     VREKLGGAPR GALEEQAAIV GTAGEFVERL GELQEAGAQR VMLQWLETDD LEGIEELASG       300
     VLPQL                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page