(data stored in ACNUC7421 zone)

EMBL: CP000386.PE278

CP000386.PE278       Location/Qualifiers
FT   CDS             complement(291382..292206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0283"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   mlo:mll7342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03259"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB9"
FT                   /protein_id="ABG03259.1"
FT                   /translation="MSLTIGTGPFGPRGGAFNFEVKAPRGHVLYFEDSPRRVRVELGGE
FT                   TVADSRRMKLLHETGLLPVYYFPEEDVRTELLERTDHTTRCPFKGEAVYWTVRAGGRTA
FT                   ENAAWAYPEPLEGAPPLGGHIAFYWDRMDRWFEEDEEVDVHPRDPYHRIDALPSSRHVR
FT                   VTVNGELVAETRRPVILFETGLPPRYYIPREDVREELLVPSESSSVCPYKGVASYWSVR
FT                   AGGETVEDLVWSYPEPRRDAERVGGLLCFFNERVDLEVDGERQERPETQWSR"
     MSLTIGTGPF GPRGGAFNFE VKAPRGHVLY FEDSPRRVRV ELGGETVADS RRMKLLHETG        60
     LLPVYYFPEE DVRTELLERT DHTTRCPFKG EAVYWTVRAG GRTAENAAWA YPEPLEGAPP       120
     LGGHIAFYWD RMDRWFEEDE EVDVHPRDPY HRIDALPSSR HVRVTVNGEL VAETRRPVIL       180
     FETGLPPRYY IPREDVREEL LVPSESSSVC PYKGVASYWS VRAGGETVED LVWSYPEPRR       240
     DAERVGGLLC FFNERVDLEV DGERQERPET QWSR                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page