(data stored in ACNUC7421 zone)

EMBL: CP000386.PE28

CP000386.PE28        Location/Qualifiers
FT   CDS             30831..31817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03009"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B019"
FT                   /protein_id="ABG03009.1"
FT                   /translation="MRVLPAWLTMLGSLLFLFVVLAFIFLVARGCIATQESTQIRKYVT
FT                   GADSLLSDSSDLGNGQLQPALKRAGGEPGRVSREALSRVADRSEDLYRRALENDEVPPE
FT                   FDDAHHYLVSALGIRAQATARLASAAGGDGGRFQQALAEAVESFRISDGIVRNHYIPAV
FT                   GDALQEAGHGRDRVYLEEPEPFMDYEEVGFEAGGASVPAQDDPNALHGVEIVSVTVAGQ
FT                   PLYPGGNVVLTGSDEPVFSVTVANGGEVPETAVPVEVILNTRAERQARTVTIERIEPGG
FT                   GQATVEVSGFRPGQLNETAEVTVKAGPVEYEDYTQNNTLTGTVTFGM"
     MRVLPAWLTM LGSLLFLFVV LAFIFLVARG CIATQESTQI RKYVTGADSL LSDSSDLGNG        60
     QLQPALKRAG GEPGRVSREA LSRVADRSED LYRRALENDE VPPEFDDAHH YLVSALGIRA       120
     QATARLASAA GGDGGRFQQA LAEAVESFRI SDGIVRNHYI PAVGDALQEA GHGRDRVYLE       180
     EPEPFMDYEE VGFEAGGASV PAQDDPNALH GVEIVSVTVA GQPLYPGGNV VLTGSDEPVF       240
     SVTVANGGEV PETAVPVEVI LNTRAERQAR TVTIERIEPG GGQATVEVSG FRPGQLNETA       300
     EVTVKAGPVE YEDYTQNNTL TGTVTFGM                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page