(data stored in ACNUC7421 zone)

EMBL: CP000386.PE281

CP000386.PE281       Location/Qualifiers
FT   CDS             complement(294628..295965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0286"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase, FAD-binding FAD dependent
FT                   oxidoreductase; KEGG: ava:Ava_1825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03262"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB6"
FT                   /protein_id="ABG03262.1"
FT                   /translation="MPEKECTPAGEAVVVGAGIAGLLAARVLCGHLRRVTVLERDALPA
FT                   GPGPRKGVPQGRHLHSLATRGSGLLEELFPGLDAELAAAGCPEIDQALDAVTALPAGTL
FT                   PRFRSGLTMRSVSRDLLEWALRRRLLREGRVRFVEGREATGLVVEGGRVRGVEARARGG
FT                   GGRERFAAGLVVDASGQGSRAPRWLSALGYEPPAETVVDARLGYATRWYRVPEGFSEGW
FT                   RSLAVLPGWPHNPRGGSLREVEGGRWTVVLLGIGGDYPPTDPEGFERFARSLPSPILHR
FT                   AIAGAEPISRVYGYRRTANRRRHYERARLPEGFLVAGDAFCTLNPSYGTGMTAAALAAR
FT                   ALEESLRDGGARRLGRRFHRRQARAVAAAWRISASSDAQWAAASSVKELGPLRRLAHRV
FT                   SEGVLRLATEDERAARRLLEVKNLLAPPQALLEPGILLPALRRALG"
     MPEKECTPAG EAVVVGAGIA GLLAARVLCG HLRRVTVLER DALPAGPGPR KGVPQGRHLH        60
     SLATRGSGLL EELFPGLDAE LAAAGCPEID QALDAVTALP AGTLPRFRSG LTMRSVSRDL       120
     LEWALRRRLL REGRVRFVEG REATGLVVEG GRVRGVEARA RGGGGRERFA AGLVVDASGQ       180
     GSRAPRWLSA LGYEPPAETV VDARLGYATR WYRVPEGFSE GWRSLAVLPG WPHNPRGGSL       240
     REVEGGRWTV VLLGIGGDYP PTDPEGFERF ARSLPSPILH RAIAGAEPIS RVYGYRRTAN       300
     RRRHYERARL PEGFLVAGDA FCTLNPSYGT GMTAAALAAR ALEESLRDGG ARRLGRRFHR       360
     RQARAVAAAW RISASSDAQW AAASSVKELG PLRRLAHRVS EGVLRLATED ERAARRLLEV       420
     KNLLAPPQAL LEPGILLPAL RRALG                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page