(data stored in ACNUC7421 zone)

EMBL: CP000386.PE287

CP000386.PE287       Location/Qualifiers
FT   CDS             299533..301887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0292"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS-like MutS III MutS II MutS IV;
FT                   KEGG: sth:STH1757 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03268"
FT                   /db_xref="GOA:Q1AZB0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZB0"
FT                   /protein_id="ABG03268.1"
FT                   /translation="MLGRYAELKAQLPPGTILFYQVGTFFETFEEDAKTVSRELSLRLT
FT                   SREAAGEGRVPLAGVPGHALQEHVAALLRKGHSVAIAEQRQHPTKPRQFTREITQILTP
FT                   GTVIEDNVLSAGRSNYLATFVVRDGKAGIAVAEASTGEFSGTVVPEAELPAELERWSPR
FT                   EVVVPERTAAEDLPRLEARVSTAPRWTFEPSAGEQALRQHFGVASLKGYGLDGSPQLVA
FT                   AAGALIRYLSTLRGGSPPEQIVSFRRYDPGQAMLLDAATRRNLGLEELISTVDRTRTPM
FT                   GQRTLRRWLERPLLEASRINQRLEAVDALFPDYMLREEVREHLGGIPDIERIATRIVRL
FT                   SASPGDLLALRGALEALGPLRRALAPAAQRSELLRRALSAMEEPPGVRELIAEAISEEE
FT                   GEIIRPGYSAELDEARSFRDGAHEWLTRFEAEERLKTGLKTLKVGYRDGEGYFIEVGGK
FT                   EAHRVPPHYEHRKALKHNARYVTVELKEHESRMLTAREEVERLERRILGEIRAAVKEAA
FT                   PQLQRIARAVAVVDVVASFAAAAAELRYCRPRVAEERGIRIVSGRHPVVEHATETPFVP
FT                   NDARIDGGSRLQIITGPNMAGKSVYLRQVALIVLLAQTGSYVPAEEASLGVVDRIFTRV
FT                   GAEDRLASGESTFMVEMTEAAGILNGATERSLVILDEVGRGTSTYDGMSLAWAIAEYLH
FT                   DDVQALTLFATHYHELTRLADSLPGCRNLKAVVEEVGGEIVFLHRIEPGAESSSYGVHV
FT                   ARLAGLPPRVTDRAQEILSRLEAEGVKGFAG"
     MLGRYAELKA QLPPGTILFY QVGTFFETFE EDAKTVSREL SLRLTSREAA GEGRVPLAGV        60
     PGHALQEHVA ALLRKGHSVA IAEQRQHPTK PRQFTREITQ ILTPGTVIED NVLSAGRSNY       120
     LATFVVRDGK AGIAVAEAST GEFSGTVVPE AELPAELERW SPREVVVPER TAAEDLPRLE       180
     ARVSTAPRWT FEPSAGEQAL RQHFGVASLK GYGLDGSPQL VAAAGALIRY LSTLRGGSPP       240
     EQIVSFRRYD PGQAMLLDAA TRRNLGLEEL ISTVDRTRTP MGQRTLRRWL ERPLLEASRI       300
     NQRLEAVDAL FPDYMLREEV REHLGGIPDI ERIATRIVRL SASPGDLLAL RGALEALGPL       360
     RRALAPAAQR SELLRRALSA MEEPPGVREL IAEAISEEEG EIIRPGYSAE LDEARSFRDG       420
     AHEWLTRFEA EERLKTGLKT LKVGYRDGEG YFIEVGGKEA HRVPPHYEHR KALKHNARYV       480
     TVELKEHESR MLTAREEVER LERRILGEIR AAVKEAAPQL QRIARAVAVV DVVASFAAAA       540
     AELRYCRPRV AEERGIRIVS GRHPVVEHAT ETPFVPNDAR IDGGSRLQII TGPNMAGKSV       600
     YLRQVALIVL LAQTGSYVPA EEASLGVVDR IFTRVGAEDR LASGESTFMV EMTEAAGILN       660
     GATERSLVIL DEVGRGTSTY DGMSLAWAIA EYLHDDVQAL TLFATHYHEL TRLADSLPGC       720
     RNLKAVVEEV GGEIVFLHRI EPGAESSSYG VHVARLAGLP PRVTDRAQEI LSRLEAEGVK       780
     GFAG                                                                    784
//

If you have problems or comments...

PBIL Back to PBIL home page