(data stored in ACNUC7421 zone)

EMBL: CP000386.PE294

CP000386.PE294       Location/Qualifiers
FT   CDS             308173..310686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0299"
FT                   /product="ATPase AAA-2"
FT                   /note="PFAM: UvrB/UvrC protein AAA ATPase, central region
FT                   Clp, N terminal ATPase associated with various cellular
FT                   activities, AAA_5 ATPase AAA-2; SMART: ATPase; KEGG:
FT                   tte:TTE2327 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03275"
FT                   /db_xref="GOA:Q1AZA3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA3"
FT                   /protein_id="ABG03275.1"
FT                   /translation="MLHNLLQQHAQGPGSLFEALSREAQEAVMRAREASAGAGGEAAIG
FT                   TDHLLAGIVAGDNLATEALRRAGADVEGMRAKFREQRGDPGEKVYTFTPSAKRALQLSF
FT                   TAARQMGAPQVGAEHLLLGLLGEGDGNAYRILSQHGAGDAEALRREILRLLQQRGGQVG
FT                   AGMPGAAPGGPGMPGGPQGPQSRTPTLDQVSRDLTRMARDGELDPVIGRAGEIARVVRI
FT                   LSRRTKNNPVLIGEAGVGKTAIAEGLAQRIVSEDVPEVLKGKRVVALDVGALVAGTRFR
FT                   GDFEERMKQLLNELQREEKNIILFIDELHTIVGAGGAEGAVTASNMLKPALARGELQVV
FT                   GATTLDEYRKHVEKDPALERRFQPVLVEEPTVDETIAILFGLRDRYEAHHRVRISDEAI
FT                   IAAAQLSERYITDRFLPDKAIDLLDEAAAEVRLRSTVPPVDLKRIEEEIASLENQKEDA
FT                   VRAEDYERAAQYKQRIEQLKLELREKQEGWAGNREANAPEVRREDIARILEEWTGIPAT
FT                   NIVQEEAERLLNLEAVLHERVIGQDEAVRAVAEAIRRARAGIKDPRRPVGSFIFLGPTG
FT                   VGKTELARTLAEYLFGEEEAMVRIDMSEYQEKHTVSRLVGAPPGYVGYEEAGQLTEQIR
FT                   RRPYSVVLFDEIEKAHPDIFNTLLQILDDGRLTDAQGRTVDFRNAVIIMTSNVGSQHLV
FT                   SERQFGFTAREGVDFREMERRARNALEQTFRPEFLNRVDEIIVFRPLSKEDVMQIVDIM
FT                   LRRLNKHLESQRISVEVTPEAREFLAEEGYDPKFGARPLSRAIRRHIENPLSSSIIEGE
FT                   FSPGDTVVVDRDGDRLTFRAKAPVS"
     MLHNLLQQHA QGPGSLFEAL SREAQEAVMR AREASAGAGG EAAIGTDHLL AGIVAGDNLA        60
     TEALRRAGAD VEGMRAKFRE QRGDPGEKVY TFTPSAKRAL QLSFTAARQM GAPQVGAEHL       120
     LLGLLGEGDG NAYRILSQHG AGDAEALRRE ILRLLQQRGG QVGAGMPGAA PGGPGMPGGP       180
     QGPQSRTPTL DQVSRDLTRM ARDGELDPVI GRAGEIARVV RILSRRTKNN PVLIGEAGVG       240
     KTAIAEGLAQ RIVSEDVPEV LKGKRVVALD VGALVAGTRF RGDFEERMKQ LLNELQREEK       300
     NIILFIDELH TIVGAGGAEG AVTASNMLKP ALARGELQVV GATTLDEYRK HVEKDPALER       360
     RFQPVLVEEP TVDETIAILF GLRDRYEAHH RVRISDEAII AAAQLSERYI TDRFLPDKAI       420
     DLLDEAAAEV RLRSTVPPVD LKRIEEEIAS LENQKEDAVR AEDYERAAQY KQRIEQLKLE       480
     LREKQEGWAG NREANAPEVR REDIARILEE WTGIPATNIV QEEAERLLNL EAVLHERVIG       540
     QDEAVRAVAE AIRRARAGIK DPRRPVGSFI FLGPTGVGKT ELARTLAEYL FGEEEAMVRI       600
     DMSEYQEKHT VSRLVGAPPG YVGYEEAGQL TEQIRRRPYS VVLFDEIEKA HPDIFNTLLQ       660
     ILDDGRLTDA QGRTVDFRNA VIIMTSNVGS QHLVSERQFG FTAREGVDFR EMERRARNAL       720
     EQTFRPEFLN RVDEIIVFRP LSKEDVMQIV DIMLRRLNKH LESQRISVEV TPEAREFLAE       780
     EGYDPKFGAR PLSRAIRRHI ENPLSSSIIE GEFSPGDTVV VDRDGDRLTF RAKAPVS          837
//

If you have problems or comments...

PBIL Back to PBIL home page