(data stored in ACNUC7421 zone)

EMBL: CP000386.PE297

CP000386.PE297       Location/Qualifiers
FT   CDS             313672..315426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0302"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase A-like; KEGG: gme:Gmet_2460 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03278"
FT                   /db_xref="GOA:Q1AZA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZA0"
FT                   /protein_id="ABG03278.1"
FT                   /translation="MSSPAHRGPGPPGARRSGLPGGLRSRAAAHLRKAALPYAVLALAL
FT                   AFTLLAWEYVRQNLEERDRDLFRNTVSAAELAVERRTRGHILALYGARALFIPGGEVDA
FT                   RDWERYVRSVRLRERFGGLLILGYAPRAPGGRERFPVRLAGPEDEAGRLLLGYDPYADP
FT                   EHRAAMERARDGGVPQATGMVYVPSEAPPGSVLDILLRRGFYVYLPVYRGGEDPGSPAD
FT                   RRRALEGFVVGIFEMEGLMRGIFRGDFAPAVDLEVYDGGRTSPEALLYDGDGVLRASDP
FT                   SAAPRFAGSSRLSVGGRRWTLFSAALPGFAGGDGALLPPLVLAVGGATGGLLFGATWLL
FT                   ASSRLRAQAAGRKLEEANRELEAFSYSVSHDLRAPLRSIEGFSQILLEDYGERLDAEGR
FT                   DYLNRVRRASQRMALLIDALLGLSRLGRREVRLARVDLSRMAREIVEELRQREPGREVE
FT                   VRVEDGLEATADPGLVKVALENLLGNAWKFTAREERAVIEFGRAVREREPGRPLSCYYV
FT                   RDNGVGFDMAYAGKLFGPFQRLHTEEEFEGTGVGLATVWRVVRRHGGVIWAEAAEGEGA
FT                   AFYFTLSP"
     MSSPAHRGPG PPGARRSGLP GGLRSRAAAH LRKAALPYAV LALALAFTLL AWEYVRQNLE        60
     ERDRDLFRNT VSAAELAVER RTRGHILALY GARALFIPGG EVDARDWERY VRSVRLRERF       120
     GGLLILGYAP RAPGGRERFP VRLAGPEDEA GRLLLGYDPY ADPEHRAAME RARDGGVPQA       180
     TGMVYVPSEA PPGSVLDILL RRGFYVYLPV YRGGEDPGSP ADRRRALEGF VVGIFEMEGL       240
     MRGIFRGDFA PAVDLEVYDG GRTSPEALLY DGDGVLRASD PSAAPRFAGS SRLSVGGRRW       300
     TLFSAALPGF AGGDGALLPP LVLAVGGATG GLLFGATWLL ASSRLRAQAA GRKLEEANRE       360
     LEAFSYSVSH DLRAPLRSIE GFSQILLEDY GERLDAEGRD YLNRVRRASQ RMALLIDALL       420
     GLSRLGRREV RLARVDLSRM AREIVEELRQ REPGREVEVR VEDGLEATAD PGLVKVALEN       480
     LLGNAWKFTA REERAVIEFG RAVREREPGR PLSCYYVRDN GVGFDMAYAG KLFGPFQRLH       540
     TEEEFEGTGV GLATVWRVVR RHGGVIWAEA AEGEGAAFYF TLSP                        584
//

If you have problems or comments...

PBIL Back to PBIL home page