(data stored in ACNUC7421 zone)

EMBL: CP000386.PE299

CP000386.PE299       Location/Qualifiers
FT   CDS             316256..316705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0304"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   dde:Dde_1416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03280"
FT                   /db_xref="GOA:Q1AZ98"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ98"
FT                   /protein_id="ABG03280.1"
FT                   /translation="MALRQKTAPTLAGLPRAEPAASRLPGLLLAALGALLIVLSAPDLA
FT                   SGAVLGGREGETLRGGLRGEALAGLSGGDALWGLGGGDLLLGGSGDDELYGGAGTDVLL
FT                   GGPGADFVEAADGEPDRILCGSGRDVASADRLDRLDSGCETVYRG"
     MALRQKTAPT LAGLPRAEPA ASRLPGLLLA ALGALLIVLS APDLASGAVL GGREGETLRG        60
     GLRGEALAGL SGGDALWGLG GGDLLLGGSG DDELYGGAGT DVLLGGPGAD FVEAADGEPD       120
     RILCGSGRDV ASADRLDRLD SGCETVYRG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page