(data stored in ACNUC7421 zone)

EMBL: CP000386.PE300

CP000386.PE300       Location/Qualifiers
FT   CDS             complement(316723..318075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0305"
FT                   /product="Tryptophan synthase, beta chain-like protein"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: ade:Adeh_3748 tryptophan synthase, beta
FT                   chain-like; TIGRFAM: Tryptophan synthase, beta chain-like;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03281"
FT                   /db_xref="GOA:Q1AZ97"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ97"
FT                   /protein_id="ABG03281.1"
FT                   /translation="MEPTKFVLGDEHIPQSWYNIVPDLPFALEPPLDPATREPVGPEAF
FT                   APIFPRAIIEQEVSAEPRVPIPEEVRKIYGLWRPTPLFRARRLERLLDTPARIYYKYEG
FT                   VSPTGSHKPNTAVPQAYYNREEGVRRLTTETGAGQWGSSLAFACRQMGLECTVYMVRVS
FT                   YDQKPYRRIMMQTYGADVHASPTDLTQAGRRILEEHPDSPGSLGIAISEAVEDAVGSED
FT                   AKYSLGSVLNHVLLHQTVIGQEAIEQMELAGEYPDVVVGCAGGGSNFGGIAFPFLRENL
FT                   LNGRDTRFIAVEPASCPTLTKGRFTYDFGDTAGTTPLMKMYTLGHSFVPAGIHAGGLRY
FT                   HGDSPILSALVHEGLVEARAYLQNETFEAGVAFARAEGIVPAPEVNHAIKAVMDLALEA
FT                   REAGEGRVILFNMCGHGHFDLSAYERYLAGELVDLQLSQEEIDRALEGLPI"
     MEPTKFVLGD EHIPQSWYNI VPDLPFALEP PLDPATREPV GPEAFAPIFP RAIIEQEVSA        60
     EPRVPIPEEV RKIYGLWRPT PLFRARRLER LLDTPARIYY KYEGVSPTGS HKPNTAVPQA       120
     YYNREEGVRR LTTETGAGQW GSSLAFACRQ MGLECTVYMV RVSYDQKPYR RIMMQTYGAD       180
     VHASPTDLTQ AGRRILEEHP DSPGSLGIAI SEAVEDAVGS EDAKYSLGSV LNHVLLHQTV       240
     IGQEAIEQME LAGEYPDVVV GCAGGGSNFG GIAFPFLREN LLNGRDTRFI AVEPASCPTL       300
     TKGRFTYDFG DTAGTTPLMK MYTLGHSFVP AGIHAGGLRY HGDSPILSAL VHEGLVEARA       360
     YLQNETFEAG VAFARAEGIV PAPEVNHAIK AVMDLALEAR EAGEGRVILF NMCGHGHFDL       420
     SAYERYLAGE LVDLQLSQEE IDRALEGLPI                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page