(data stored in ACNUC7421 zone)

EMBL: CP000386.PE31

CP000386.PE31        Location/Qualifiers
FT   CDS             complement(33290..33895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0031"
FT                   /product="Redoxin"
FT                   /note="PFAM: Redoxin Thioredoxin domain; KEGG: sth:STH734
FT                   cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03012"
FT                   /db_xref="GOA:Q1B016"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B016"
FT                   /protein_id="ABG03012.1"
FT                   /translation="MARNTPSGGKKRGAGAPQANRPLVLALAGFTALAIVVIALLAVLS
FT                   ARGGDAGNFTPNDQGLLPVGSQAPDFTTKTVTGERVSLPEGQAAMLVFFATWCPHCQNE
FT                   APTIADFSREYEDLRVMMISVADENWPETDTPQEVRRFVSEYGIQGPAIYDPELGRTYR
FT                   VTGTPTVYVVDANGTIVGAHSGEAPREVYEGWIQEALG"
     MARNTPSGGK KRGAGAPQAN RPLVLALAGF TALAIVVIAL LAVLSARGGD AGNFTPNDQG        60
     LLPVGSQAPD FTTKTVTGER VSLPEGQAAM LVFFATWCPH CQNEAPTIAD FSREYEDLRV       120
     MMISVADENW PETDTPQEVR RFVSEYGIQG PAIYDPELGR TYRVTGTPTV YVVDANGTIV       180
     GAHSGEAPRE VYEGWIQEAL G                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page