(data stored in ACNUC7421 zone)

EMBL: CP000386.PE311

CP000386.PE311       Location/Qualifiers
FT   CDS             336928..339096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0316"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: mag:amb3065 1,4-alpha-glucan branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: glycoside
FT                   hydrolase, family 13-like alpha amylase, catalytic region;
FT                   SMART: Alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03292"
FT                   /db_xref="GOA:Q1AZ86"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ86"
FT                   /protein_id="ABG03292.1"
FT                   /translation="MRREEAIRAVVAGDHPDPFSFLGPHEEAGRRVVRTFLPGAARVRV
FT                   LSAAGRPLGELERVHPEGFFSGPLSGNGRYRLRVLWEGGGEDELEDPYRFPPVLSDYDL
FT                   YLFGEGNNHRIYRHLGAHPAEMDGVCGTAFAVWAPNARRVSVVGDFNLWDGRRHPMRNR
FT                   NGVWEIFLPGVGPGALYKYEIKDAGGSLLPLKADPYGFFAEQYPGTASIVWDLSRHRWE
FT                   DGEWMERRGSRNAPDAPMAIYEVHLGSWRRRPDGSHLTYRELAEELVPYVAGLGYTHVE
FT                   LLPPMEHPFGGSWGYQPVGLFAPTSRFGPPEDFKHLVDAFHRAGVGVIADWVPAHFPED
FT                   AHGLARFDGTHLYEHADPRKGRHPDWGTLIYNYGRNEVRNFLISNALFWLDEYHIDGLR
FT                   VDAVASMLYLDYSRKEGEWVPNEHGGNENLEAIAFLRRMNEVVYGEAPGAFTVAEESTA
FT                   WPMVSRPTYMGGLGFGYKWNMGWMHDTLQYMKEDPVHRRYHHDRITFGLLYAFNENFIL
FT                   PLSHDEVVHGKGSLLGRMPGDRWQRFANLRAYYGFMYGHPGKQLLFMGGEFAQEREWDS
FT                   GSQLDWHLLEGGENRGVRDLVADLNALYRATPALHQVDFEPEGFEWVEGGDAEQSVVSF
FT                   LRRARNPEDFVLVVSNFTPVVRHGYRVGVPASGPYAEVLNTDDPRYGGSGVANGELEAE
FT                   EVPWHGRPFSLRLTLPPLATVFLRPRPV"
     MRREEAIRAV VAGDHPDPFS FLGPHEEAGR RVVRTFLPGA ARVRVLSAAG RPLGELERVH        60
     PEGFFSGPLS GNGRYRLRVL WEGGGEDELE DPYRFPPVLS DYDLYLFGEG NNHRIYRHLG       120
     AHPAEMDGVC GTAFAVWAPN ARRVSVVGDF NLWDGRRHPM RNRNGVWEIF LPGVGPGALY       180
     KYEIKDAGGS LLPLKADPYG FFAEQYPGTA SIVWDLSRHR WEDGEWMERR GSRNAPDAPM       240
     AIYEVHLGSW RRRPDGSHLT YRELAEELVP YVAGLGYTHV ELLPPMEHPF GGSWGYQPVG       300
     LFAPTSRFGP PEDFKHLVDA FHRAGVGVIA DWVPAHFPED AHGLARFDGT HLYEHADPRK       360
     GRHPDWGTLI YNYGRNEVRN FLISNALFWL DEYHIDGLRV DAVASMLYLD YSRKEGEWVP       420
     NEHGGNENLE AIAFLRRMNE VVYGEAPGAF TVAEESTAWP MVSRPTYMGG LGFGYKWNMG       480
     WMHDTLQYMK EDPVHRRYHH DRITFGLLYA FNENFILPLS HDEVVHGKGS LLGRMPGDRW       540
     QRFANLRAYY GFMYGHPGKQ LLFMGGEFAQ EREWDSGSQL DWHLLEGGEN RGVRDLVADL       600
     NALYRATPAL HQVDFEPEGF EWVEGGDAEQ SVVSFLRRAR NPEDFVLVVS NFTPVVRHGY       660
     RVGVPASGPY AEVLNTDDPR YGGSGVANGE LEAEEVPWHG RPFSLRLTLP PLATVFLRPR       720
     PV                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page