(data stored in ACNUC7421 zone)

EMBL: CP000386.PE319

CP000386.PE319       Location/Qualifiers
FT   CDS             348184..348999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0324"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase
FT                   short-chain dehydrogenase/reductase SDR; KEGG: mlo:mlr1637
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03300"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ78"
FT                   /protein_id="ABG03300.1"
FT                   /translation="MEAGNTKTALVTGSTDGLGRGVARELARRGYAVILHGRSEARCEE
FT                   AAAELPGGAAGYLVADLSSLGEVRKMAREVLAGRERLDLLVNNAGVISRERRESREGFE
FT                   LTFAVNYLSHFLLTLLLLPLLRRSAPARVVNVASAAQSPIDFEDPMMERSYSPMEAYAR
FT                   SKLAQVMFSFALAGRLSGTGVCVNALHPASLMDTKMVRESFGRPMSSVEEGVRAVVRLA
FT                   ASSELEGVSGRYFEGTREARAHPQAYDPAARERLWELSEGLCGALDAGR"
     MEAGNTKTAL VTGSTDGLGR GVARELARRG YAVILHGRSE ARCEEAAAEL PGGAAGYLVA        60
     DLSSLGEVRK MAREVLAGRE RLDLLVNNAG VISRERRESR EGFELTFAVN YLSHFLLTLL       120
     LLPLLRRSAP ARVVNVASAA QSPIDFEDPM MERSYSPMEA YARSKLAQVM FSFALAGRLS       180
     GTGVCVNALH PASLMDTKMV RESFGRPMSS VEEGVRAVVR LAASSELEGV SGRYFEGTRE       240
     ARAHPQAYDP AARERLWELS EGLCGALDAG R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page