(data stored in ACNUC7421 zone)

EMBL: CP000386.PE322

CP000386.PE322       Location/Qualifiers
FT   CDS             complement(350965..353022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0327"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: chy:CHY_1100 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif BRCT NAD-dependent DNA ligase
FT                   zinc-finger, NAD-dependent DNA ligase C4-type NAD-dependent
FT                   DNA ligase, OB-fold; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03303"
FT                   /db_xref="GOA:Q1AZ75"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1AZ75"
FT                   /protein_id="ABG03303.1"
FT                   /translation="MGAPTLPRIIPPVAEKLAEARQRVEELREQIRYHNRKYYVEDAPE
FT                   ISDAEYDALYRELEELESRFPELVTPDSPTQRVGGEPLEEFEEVRHAVPMLSLQNARRV
FT                   EELREWDARVRRLLGPEEEGRLRYVTELKIDGLAVSLRYENGRLVRGATRGNGFVGEDV
FT                   TRQLRTIRSVPDRLDDDPPGVLEPRGEVYIKLKDFEEFNRRRQERGERPFANPRNLAAG
FT                   SVRQLDPRVTARRPLTIYLYGVGEGYENFESHSEALAALRRYGLRVNPHTVHGDIDSVI
FT                   EECGRWAKKREALDFQVDGVVVKVDSREQQERLGAVQKAPRWAIAYKFEPLAGRTRLRD
FT                   IVVTVGRTGALTPQAVLEPVNVGGVTISRATLHNEDYIKEKGILIGDTVIVERAGDVIP
FT                   QVVRPVPEERDGDEEEFRMPERCPVCGERVSRPEGEAITRCANVRCPAQALEHIIHWAS
FT                   RGAMDIEGLGEKLARKLFDLGLIRDVADLYELRAEQLAPLEGLGEKSAQNLIRAIERSK
FT                   ERPFDRVLFGLGIRHVGSATAELIAERFSGEELLRGVGVEELTQIEGVGEIVARAVVEY
FT                   FSLEENRKLVRRLMEHGLNFGPVRGKPEEGPLSGRRLVITGTLSRPRSEISDLIEGAGG
FT                   TVTSSVSRNTDYLVAGENPGSKLERARELGVPVLDEEGLRRLLSGEERPG"
     MGAPTLPRII PPVAEKLAEA RQRVEELREQ IRYHNRKYYV EDAPEISDAE YDALYRELEE        60
     LESRFPELVT PDSPTQRVGG EPLEEFEEVR HAVPMLSLQN ARRVEELREW DARVRRLLGP       120
     EEEGRLRYVT ELKIDGLAVS LRYENGRLVR GATRGNGFVG EDVTRQLRTI RSVPDRLDDD       180
     PPGVLEPRGE VYIKLKDFEE FNRRRQERGE RPFANPRNLA AGSVRQLDPR VTARRPLTIY       240
     LYGVGEGYEN FESHSEALAA LRRYGLRVNP HTVHGDIDSV IEECGRWAKK REALDFQVDG       300
     VVVKVDSREQ QERLGAVQKA PRWAIAYKFE PLAGRTRLRD IVVTVGRTGA LTPQAVLEPV       360
     NVGGVTISRA TLHNEDYIKE KGILIGDTVI VERAGDVIPQ VVRPVPEERD GDEEEFRMPE       420
     RCPVCGERVS RPEGEAITRC ANVRCPAQAL EHIIHWASRG AMDIEGLGEK LARKLFDLGL       480
     IRDVADLYEL RAEQLAPLEG LGEKSAQNLI RAIERSKERP FDRVLFGLGI RHVGSATAEL       540
     IAERFSGEEL LRGVGVEELT QIEGVGEIVA RAVVEYFSLE ENRKLVRRLM EHGLNFGPVR       600
     GKPEEGPLSG RRLVITGTLS RPRSEISDLI EGAGGTVTSS VSRNTDYLVA GENPGSKLER       660
     ARELGVPVLD EEGLRRLLSG EERPG                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page