(data stored in ACNUC7421 zone)

EMBL: CP000386.PE324

CP000386.PE324       Location/Qualifiers
FT   CDS             353594..354160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03305"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ73"
FT                   /protein_id="ABG03305.1"
FT                   /translation="MLLVCALGLALLPGCSREEGGAPGSFAGETTAAPVRWTTALAGVE
FT                   EAAGEARRWREDAELYAIATPEPALDARGRAPAWLYTFVSPSAGAVASVEVRGGEARRL
FT                   PEQPLPEADIRNLRRNALPPPERLLDSDEALRRAREVRGLLSGRGGRTASAGLDSLSGG
FT                   GPVWIFATVSEGRRLEERVPALSGG"
     MLLVCALGLA LLPGCSREEG GAPGSFAGET TAAPVRWTTA LAGVEEAAGE ARRWREDAEL        60
     YAIATPEPAL DARGRAPAWL YTFVSPSAGA VASVEVRGGE ARRLPEQPLP EADIRNLRRN       120
     ALPPPERLLD SDEALRRARE VRGLLSGRGG RTASAGLDSL SGGGPVWIFA TVSEGRRLEE       180
     RVPALSGG                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page