(data stored in ACNUC7421 zone)

EMBL: CP000386.PE325

CP000386.PE325       Location/Qualifiers
FT   CDS             complement(354157..354471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03306"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ72"
FT                   /protein_id="ABG03306.1"
FT                   /translation="MEEANHRPDNPYTEWEGYEVLDAAGEPLGRVERTVYDAPSGVLKY
FT                   LCVGGRAVPAEGLDAEPDRRRVLLPHPAEKVRSAPPLEERPDGDFDRRVRRHYGLERPR
FT                   "
     MEEANHRPDN PYTEWEGYEV LDAAGEPLGR VERTVYDAPS GVLKYLCVGG RAVPAEGLDA        60
     EPDRRRVLLP HPAEKVRSAP PLEERPDGDF DRRVRRHYGL ERPR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page