(data stored in ACNUC7421 zone)

EMBL: CP000386.PE326

CP000386.PE326       Location/Qualifiers
FT   CDS             354489..355511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa40670 putative translation initiation
FT                   factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03307"
FT                   /db_xref="GOA:Q1AZ71"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ71"
FT                   /protein_id="ABG03307.1"
FT                   /translation="MAGTTRCAYDTSDVSGESSHRRNARCLKALALLYLALVGASFLLV
FT                   YGDAYEPAVHMLLFLAACSVGATASVAVLLLPVEQFSGGFSGGVYALLAASTAMMTFFS
FT                   GGTSSELYLLFFPLLLAAALHGSWRVALFALASVLLFYALAVMPGLLNEEADASVAAPV
FT                   LYRLAALGLTGAFVAAASRLSSGGGEEEYIVPDEDGSLLLERVEREISARRGVQVAVIL
FT                   VDPGRGVEDVEALLERVRARIAEPVLLGEGAVFGMVLSGVGDREIESAARRALAAAGSL
FT                   GAGETRAGVAVYPRDARSAEDLLVAAGRALEAAFEVDSPSAIVLAGRRAAREEGRRAAR
FT                   "
     MAGTTRCAYD TSDVSGESSH RRNARCLKAL ALLYLALVGA SFLLVYGDAY EPAVHMLLFL        60
     AACSVGATAS VAVLLLPVEQ FSGGFSGGVY ALLAASTAMM TFFSGGTSSE LYLLFFPLLL       120
     AAALHGSWRV ALFALASVLL FYALAVMPGL LNEEADASVA APVLYRLAAL GLTGAFVAAA       180
     SRLSSGGGEE EYIVPDEDGS LLLERVEREI SARRGVQVAV ILVDPGRGVE DVEALLERVR       240
     ARIAEPVLLG EGAVFGMVLS GVGDREIESA ARRALAAAGS LGAGETRAGV AVYPRDARSA       300
     EDLLVAAGRA LEAAFEVDSP SAIVLAGRRA AREEGRRAAR                             340
//

If you have problems or comments...

PBIL Back to PBIL home page