(data stored in ACNUC7421 zone)

EMBL: CP000386.PE332

CP000386.PE332       Location/Qualifiers
FT   CDS             359757..360392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03313"
FT                   /db_xref="GOA:Q1AZ65"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ65"
FT                   /protein_id="ABG03313.1"
FT                   /translation="MSGGWPWIALAALGAYHGLNPAMGWLFAVALGLQERRRGAVLGAL
FT                   PPIALGHAAAVAAALLVLGAAGLAAPPDLLRYGCAAVLVLFGLYRLLRRRHPRWVGMRV
FT                   GFRDLAAWSFLMATAHGAGLMLFPVLLGLSSGHGAHAAHAGMAAPGGLWTGLAAVGLHT
FT                   LAMFAVMAAVAVVVYERLGVMILKRTWFNLDLLWAGVLIGAGVLTLFV"
     MSGGWPWIAL AALGAYHGLN PAMGWLFAVA LGLQERRRGA VLGALPPIAL GHAAAVAAAL        60
     LVLGAAGLAA PPDLLRYGCA AVLVLFGLYR LLRRRHPRWV GMRVGFRDLA AWSFLMATAH       120
     GAGLMLFPVL LGLSSGHGAH AAHAGMAAPG GLWTGLAAVG LHTLAMFAVM AAVAVVVYER       180
     LGVMILKRTW FNLDLLWAGV LIGAGVLTLF V                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page