(data stored in ACNUC7421 zone)

EMBL: CP000386.PE336

CP000386.PE336       Location/Qualifiers
FT   CDS             362408..366877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0341"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II glutamate
FT                   synthase, alpha subunit-like ferredoxin-dependent glutamate
FT                   synthase glutamate synthase; KEGG: mca:MCA2039 glutamate
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03317"
FT                   /db_xref="GOA:Q1AZ61"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ61"
FT                   /protein_id="ABG03317.1"
FT                   /translation="MTLKTGLYDPAYEHDACGFGFVARVDGRKTRETVEEGLEILRNLE
FT                   HRGARGSDPETGDGAGILLQLPDAFFRREAGRLGIELPPPGHYAVGTLFESEEGLGAER
FT                   MLEEIAAEEGQRVLGFRDVPVDAERCGRLARRVMPRIRQFFVGREAPDEMAFERKLYVI
FT                   RRRLHKAVADTHACYVVTLSSRTIVYKGLLTGVQLPEFYLDLQDPAVQSAIALVHARFS
FT                   TNTLGSWELAHPYRYVAHNGEINTLRGNINWMRARESRLESELFGEDLGKISPVIQPGG
FT                   SDSAAFDNVLELLYLAGRSLPHAVAMMVPEAWENDELMDPERRAFYRYHSALMEPWDGP
FT                   AAVAFTDGRLIGATLDRNGLRPARYSVTKDGRVIMASEDGALRVPAEEVVERWRLQPGR
FT                   MLVVDTERHEILHDEDVKRPLFRRRPYARWLEEQEIHLDELPDVEPDPRPEPATLFERQ
FT                   RAFGYTVEDLRLLLTPMARGGKEPDGSMGTDTPLAVLSERPQLLFNYFKQHFAQVTNPP
FT                   IDPLREELVMSLKMSLGPEQNLFDETPRHCRRVLLDHPILTGPELEKVRHLGREPFSAT
FT                   TLSALFPAAGGGEGLRRALESLCERAERAVRGGSPVLVLSDRGVSHNQAPIPSLLATAA
FT                   VHHHLVRRGIRTATTLVVETAEAREVHHFALLVGYGATAVSPYLAFETIEKLARDGMLG
FT                   GVGPEEAQENYIKAVQKGLLKILSKMGISTLLSYCGAQIFEAVGLSREVIDRYFTGTAS
FT                   RIGGVGLEEIAREVLMRHEAAFRAGELGPEELDVGGEYQQRQQGQYHQWNPETIVPLQR
FT                   AVRTRSFETFKEFTRHFDERSARFATLRGLLEFEEDPIPLEEVEPAREIVRRFTTGAMS
FT                   LGALSKEAHETLAVAMNRIGGKSNTGEGGEDPERFGDERRSAIKQVASGRFGVTTEYLV
FT                   NADMLQIKMAQGSKPGEGGQLPGHKVSGYIAKIRYSTPGVGLISPPPHHDIYSIEDLAQ
FT                   LIHDLKNANPRALVSVKLVAEAGVGTIAAGVAKAKADHITISGHDGGTGASPLSSIKHA
FT                   GLPWELGLAETQQVLVQNDLRGRVVLETDGQLKTGRDVVVAALLGAEEFAFSTAPLVTV
FT                   GCIMMRVCHLNTCPVGVATQDPVLRKKFAGAPEHVINYFFFLAEEVREYMARMGFRTFE
FT                   EMVGRCDRLRPRAALDHWKARGVDLSPLLHRPQIPQGVAIRHVQQQNHNLEKALDNELI
FT                   RRCRPALEGGEPVRFSRLILNTNRTVGGMLSGEVARRYGQEGLPDGTIRIDFKGVAGQS
FT                   FGAWLAKGITFTLEGTTNDYAGKGLSGGRLAVFPSREAAYRPEEAIVVGNVALYGATGG
FT                   EAYFRGFAGERFCVRNSGARAVVEGVGDHGCEYMTGGVVVVLGPTGRNFAAGMSGGMAF
FT                   VLDEESRFEKLCNTDMVGLEAVESEEDVALLRGMVEAHLRWTSSAVARRVLEEWEALLP
FT                   KFVKVMPHDLRRVLEERRRAEEEVEVAG"
     MTLKTGLYDP AYEHDACGFG FVARVDGRKT RETVEEGLEI LRNLEHRGAR GSDPETGDGA        60
     GILLQLPDAF FRREAGRLGI ELPPPGHYAV GTLFESEEGL GAERMLEEIA AEEGQRVLGF       120
     RDVPVDAERC GRLARRVMPR IRQFFVGREA PDEMAFERKL YVIRRRLHKA VADTHACYVV       180
     TLSSRTIVYK GLLTGVQLPE FYLDLQDPAV QSAIALVHAR FSTNTLGSWE LAHPYRYVAH       240
     NGEINTLRGN INWMRARESR LESELFGEDL GKISPVIQPG GSDSAAFDNV LELLYLAGRS       300
     LPHAVAMMVP EAWENDELMD PERRAFYRYH SALMEPWDGP AAVAFTDGRL IGATLDRNGL       360
     RPARYSVTKD GRVIMASEDG ALRVPAEEVV ERWRLQPGRM LVVDTERHEI LHDEDVKRPL       420
     FRRRPYARWL EEQEIHLDEL PDVEPDPRPE PATLFERQRA FGYTVEDLRL LLTPMARGGK       480
     EPDGSMGTDT PLAVLSERPQ LLFNYFKQHF AQVTNPPIDP LREELVMSLK MSLGPEQNLF       540
     DETPRHCRRV LLDHPILTGP ELEKVRHLGR EPFSATTLSA LFPAAGGGEG LRRALESLCE       600
     RAERAVRGGS PVLVLSDRGV SHNQAPIPSL LATAAVHHHL VRRGIRTATT LVVETAEARE       660
     VHHFALLVGY GATAVSPYLA FETIEKLARD GMLGGVGPEE AQENYIKAVQ KGLLKILSKM       720
     GISTLLSYCG AQIFEAVGLS REVIDRYFTG TASRIGGVGL EEIAREVLMR HEAAFRAGEL       780
     GPEELDVGGE YQQRQQGQYH QWNPETIVPL QRAVRTRSFE TFKEFTRHFD ERSARFATLR       840
     GLLEFEEDPI PLEEVEPARE IVRRFTTGAM SLGALSKEAH ETLAVAMNRI GGKSNTGEGG       900
     EDPERFGDER RSAIKQVASG RFGVTTEYLV NADMLQIKMA QGSKPGEGGQ LPGHKVSGYI       960
     AKIRYSTPGV GLISPPPHHD IYSIEDLAQL IHDLKNANPR ALVSVKLVAE AGVGTIAAGV      1020
     AKAKADHITI SGHDGGTGAS PLSSIKHAGL PWELGLAETQ QVLVQNDLRG RVVLETDGQL      1080
     KTGRDVVVAA LLGAEEFAFS TAPLVTVGCI MMRVCHLNTC PVGVATQDPV LRKKFAGAPE      1140
     HVINYFFFLA EEVREYMARM GFRTFEEMVG RCDRLRPRAA LDHWKARGVD LSPLLHRPQI      1200
     PQGVAIRHVQ QQNHNLEKAL DNELIRRCRP ALEGGEPVRF SRLILNTNRT VGGMLSGEVA      1260
     RRYGQEGLPD GTIRIDFKGV AGQSFGAWLA KGITFTLEGT TNDYAGKGLS GGRLAVFPSR      1320
     EAAYRPEEAI VVGNVALYGA TGGEAYFRGF AGERFCVRNS GARAVVEGVG DHGCEYMTGG      1380
     VVVVLGPTGR NFAAGMSGGM AFVLDEESRF EKLCNTDMVG LEAVESEEDV ALLRGMVEAH      1440
     LRWTSSAVAR RVLEEWEALL PKFVKVMPHD LRRVLEERRR AEEEVEVAG                  1489
//

If you have problems or comments...

PBIL Back to PBIL home page