(data stored in ACNUC7421 zone)

EMBL: CP000386.PE339

CP000386.PE339       Location/Qualifiers
FT   CDS             370137..370697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0344"
FT                   /product="LemA"
FT                   /note="PFAM: LemA; KEGG: bcl:ABC1505 Listeria epitope LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03320"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ58"
FT                   /protein_id="ABG03320.1"
FT                   /translation="MGTVLTIIVVVAVVAVAVYAVATYNGLVRRRNEVEEAYRQIDVQL
FT                   KRRYDLIPNLLEGVKRYFRQEQDVLTEITRARSAAMQPHSPREQAQAEARLSGAIGNLF
FT                   AVAENYPELRSERVLLDFQEELASTENKISFARQHYNDSVQAYNTKIQSFPAVIFARAM
FT                   GFTEKEYFEAAGPERESVTVSYD"
     MGTVLTIIVV VAVVAVAVYA VATYNGLVRR RNEVEEAYRQ IDVQLKRRYD LIPNLLEGVK        60
     RYFRQEQDVL TEITRARSAA MQPHSPREQA QAEARLSGAI GNLFAVAENY PELRSERVLL       120
     DFQEELASTE NKISFARQHY NDSVQAYNTK IQSFPAVIFA RAMGFTEKEY FEAAGPERES       180
     VTVSYD                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page