(data stored in ACNUC7421 zone)

EMBL: CP000386.PE342

CP000386.PE342       Location/Qualifiers
FT   CDS             complement(372838..373440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0347"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pfo:Pfl_3944
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03323"
FT                   /db_xref="GOA:Q1AZ55"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ55"
FT                   /protein_id="ABG03323.1"
FT                   /translation="MAERFDSTSARLHAAAAGLFWNKGYAATTTRELASLLGLQKASLY
FT                   HHMESKEELLYSLCVESLGNIRSAVEEAVGEAGDPLERVRALIRAHVVSMLVDKEKHAT
FT                   MLTELRSLSEERRREVIRLRDEYERIVRSVLAEGQRAGVLRGDLPAKHLALCLLDLMNW
FT                   AIFWFRSGEELSPERLAGVFTTLFLEGAGSKGEPPPS"
     MAERFDSTSA RLHAAAAGLF WNKGYAATTT RELASLLGLQ KASLYHHMES KEELLYSLCV        60
     ESLGNIRSAV EEAVGEAGDP LERVRALIRA HVVSMLVDKE KHATMLTELR SLSEERRREV       120
     IRLRDEYERI VRSVLAEGQR AGVLRGDLPA KHLALCLLDL MNWAIFWFRS GEELSPERLA       180
     GVFTTLFLEG AGSKGEPPPS                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page