(data stored in ACNUC7421 zone)

EMBL: CP000386.PE345

CP000386.PE345       Location/Qualifiers
FT   CDS             375803..376993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0350"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment catalytic domain of
FT                   components of various dehydrogenase complexes E3 binding;
FT                   KEGG: tfu:Tfu_3051 pyruvate dehydrogenase complex, E2
FT                   component, dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03326"
FT                   /db_xref="GOA:Q1AZ52"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ52"
FT                   /protein_id="ABG03326.1"
FT                   /translation="MHKLHLPRLGQTMERGTILRWARREGEPFEVGDILYEVESEKAVN
FT                   EIEAKLPGTLARITVEEGQECPVGTLLAVVADPGETLSEEEIEAAIAEEGGREAPAASG
FT                   GGTGVRAPSSARAQRRVRAMPKARALARELGVELAAVEGTGQGGAITVEDVRRAAGAAP
FT                   GEGPRVRERRPLGDVGRTMARVVTRSWHEVPQFVQMVQLDASALVGRRRELAGQIKRSH
FT                   GVDLSYTDLLLEAVAGAAGEEPLANSSLVDGEILLYEDVNVSVAVATGSGLLVPVVRWA
FT                   QALELGELAARLREVLERARSGRLSAEDTAGGTITLSNLGMYGIEGGTPLVTHPQAAVV
FT                   FAGAIVERPWAVSGRVEVRPTLTLSVGFDHRILDGVAAARFTTALRRRLESPNQEG"
     MHKLHLPRLG QTMERGTILR WARREGEPFE VGDILYEVES EKAVNEIEAK LPGTLARITV        60
     EEGQECPVGT LLAVVADPGE TLSEEEIEAA IAEEGGREAP AASGGGTGVR APSSARAQRR       120
     VRAMPKARAL ARELGVELAA VEGTGQGGAI TVEDVRRAAG AAPGEGPRVR ERRPLGDVGR       180
     TMARVVTRSW HEVPQFVQMV QLDASALVGR RRELAGQIKR SHGVDLSYTD LLLEAVAGAA       240
     GEEPLANSSL VDGEILLYED VNVSVAVATG SGLLVPVVRW AQALELGELA ARLREVLERA       300
     RSGRLSAEDT AGGTITLSNL GMYGIEGGTP LVTHPQAAVV FAGAIVERPW AVSGRVEVRP       360
     TLTLSVGFDH RILDGVAAAR FTTALRRRLE SPNQEG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page