(data stored in ACNUC7421 zone)

EMBL: CP000386.PE349

CP000386.PE349       Location/Qualifiers
FT   CDS             complement(380534..380947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03330"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ48"
FT                   /protein_id="ABG03330.1"
FT                   /translation="MNGGSFRPGKREDYIHLVEERYFANVDHKNLEAVLDCFTEDATFT
FT                   IQSAFSTHRGRDTGIRRMFERLFERYSKTVHRGFRHVVDIEGECCASQFEVENVSARDG
FT                   TETRLSNCNFFYLEGGRFKRVYVYMSGGMNTLG"
     MNGGSFRPGK REDYIHLVEE RYFANVDHKN LEAVLDCFTE DATFTIQSAF STHRGRDTGI        60
     RRMFERLFER YSKTVHRGFR HVVDIEGECC ASQFEVENVS ARDGTETRLS NCNFFYLEGG       120
     RFKRVYVYMS GGMNTLG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page