(data stored in ACNUC7421 zone)

EMBL: CP000386.PE35

CP000386.PE35        Location/Qualifiers
FT   CDS             37137..37619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0035"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment; KEGG:
FT                   ava:Ava_2314 acetyl-CoA biotin carboxyl carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03016"
FT                   /db_xref="GOA:Q1B012"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B012"
FT                   /protein_id="ABG03016.1"
FT                   /translation="MQEIDEKNRREAAAGPLPLEEVGRLVELLRSSGVGEISVRRGELE
FT                   ISVKALPEARPVQAAPAAPAPAPAAEGGAEEEESGLHAVRSPLVGTFYRAPAPGEEPYV
FT                   EVGDRVSAGQTLCIVEAMKLMNEIPADVSGEVVEVLVQDGQGVEYDQPLFRIRPEG"
     MQEIDEKNRR EAAAGPLPLE EVGRLVELLR SSGVGEISVR RGELEISVKA LPEARPVQAA        60
     PAAPAPAPAA EGGAEEEESG LHAVRSPLVG TFYRAPAPGE EPYVEVGDRV SAGQTLCIVE       120
     AMKLMNEIPA DVSGEVVEVL VQDGQGVEYD QPLFRIRPEG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page