(data stored in ACNUC7421 zone)

EMBL: CP000386.PE352

CP000386.PE352       Location/Qualifiers
FT   CDS             complement(383047..384411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0357"
FT                   /product="MmgE/PrpD"
FT                   /note="PFAM: MmgE/PrpD; KEGG: bbr:BB1350 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03333"
FT                   /db_xref="GOA:Q1AZ45"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ45"
FT                   /protein_id="ABG03333.1"
FT                   /translation="MRQGTVPPAEPSRRTAAALEDLGRFVSGLDPADHPGLREPLLRTL
FT                   LDTLGVSVAGSRTPELRALVAAWEPPPGPAAIFGAGVRTVPETAAYLNGVSAVTLELDE
FT                   GNKYARGHPASHVFPAALAVAQARGATGRELAAALLAGYEVASRFGRATRLRPGVHPHG
FT                   NWGTAGAAAAVARLMGLDAPAVADALDVACATVLATPFEAALAGSAARNGWVGTSNVSG
FT                   IAAARMAAAGIAGNAGLAAVTLGDILGELDPEELTRGLGERFDIERGYFKRHASCSYTH
FT                   PPADAVLEILRENPRLDPARVRQITVETHGLAAPLNRTDCPTRLAAMFSIPYVVSVALV
FT                   TGGCGPEAFGDARRADPAVRRLMRVTRVAAAEEINRRLPEERAARVKITLDDGTSLAAE
FT                   VPNPVGDAAHHPFGLREIRQKLDGLLGREAAEAIESIAQDLPECENVNDVLERSP"
     MRQGTVPPAE PSRRTAAALE DLGRFVSGLD PADHPGLREP LLRTLLDTLG VSVAGSRTPE        60
     LRALVAAWEP PPGPAAIFGA GVRTVPETAA YLNGVSAVTL ELDEGNKYAR GHPASHVFPA       120
     ALAVAQARGA TGRELAAALL AGYEVASRFG RATRLRPGVH PHGNWGTAGA AAAVARLMGL       180
     DAPAVADALD VACATVLATP FEAALAGSAA RNGWVGTSNV SGIAAARMAA AGIAGNAGLA       240
     AVTLGDILGE LDPEELTRGL GERFDIERGY FKRHASCSYT HPPADAVLEI LRENPRLDPA       300
     RVRQITVETH GLAAPLNRTD CPTRLAAMFS IPYVVSVALV TGGCGPEAFG DARRADPAVR       360
     RLMRVTRVAA AEEINRRLPE ERAARVKITL DDGTSLAAEV PNPVGDAAHH PFGLREIRQK       420
     LDGLLGREAA EAIESIAQDL PECENVNDVL ERSP                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page