(data stored in ACNUC7421 zone)

EMBL: CP000386.PE355

CP000386.PE355       Location/Qualifiers
FT   CDS             complement(386592..387323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0360"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   ape:APE2524 putative branched-chain amino acid transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03336"
FT                   /db_xref="GOA:Q1AZ42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ42"
FT                   /protein_id="ABG03336.1"
FT                   /translation="MTLLEVQDVSKSFAGLRALHSVSLQVERGSIVGLIGPNGAGKTTL
FT                   FNVIAGVMKPDAGRVLFDGTDVTGWPPYRIARLGIGRTFQLMKPFDTLSVLDNVTVATL
FT                   QRHRSRKEARRAATEVVERVGLGEWADRKASVLSTAGYKRLELAKALGLEPSLLLLDEV
FT                   LAGLVPAERARVVELLREIRAEGVTMLLVEHVMSAVMALSDHVYVLHHGEMLASGTPEE
FT                   VTKDPRVIEAYLGEEGHHAGA"
     MTLLEVQDVS KSFAGLRALH SVSLQVERGS IVGLIGPNGA GKTTLFNVIA GVMKPDAGRV        60
     LFDGTDVTGW PPYRIARLGI GRTFQLMKPF DTLSVLDNVT VATLQRHRSR KEARRAATEV       120
     VERVGLGEWA DRKASVLSTA GYKRLELAKA LGLEPSLLLL DEVLAGLVPA ERARVVELLR       180
     EIRAEGVTML LVEHVMSAVM ALSDHVYVLH HGEMLASGTP EEVTKDPRVI EAYLGEEGHH       240
     AGA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page