(data stored in ACNUC7421 zone)

EMBL: CP000386.PE361

CP000386.PE361       Location/Qualifiers
FT   CDS             392796..393656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0366"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bte:BTH_II2226
FT                   probable citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03342"
FT                   /db_xref="GOA:Q1AZ36"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ36"
FT                   /protein_id="ABG03342.1"
FT                   /translation="MTPTAAPPRSYLYVPGSDPRRIEKALSSEADAVVLDLEDAVAPDH
FT                   KEEARENVAGVLARANRKPVFVRVNAPGSALCGRDVEAVARPGLAGVRLPKTESAEEVR
FT                   RVAERLEELGCEAGVQCLIESALGLEMAFELARSHPRVTGLSLGEADLAADLGASGEEG
FT                   LLYARSRVVAASRAAGLQRPVQSVYTNVRDLDGLRRSTEAGKRLGFFGRSAIHPAQLPV
FT                   INEVFTPTEEEVAEARELLSRMEGAAASGSGAFVLEDGRFVDEAVVRAARFTLAVARGA
FT                   NGEER"
     MTPTAAPPRS YLYVPGSDPR RIEKALSSEA DAVVLDLEDA VAPDHKEEAR ENVAGVLARA        60
     NRKPVFVRVN APGSALCGRD VEAVARPGLA GVRLPKTESA EEVRRVAERL EELGCEAGVQ       120
     CLIESALGLE MAFELARSHP RVTGLSLGEA DLAADLGASG EEGLLYARSR VVAASRAAGL       180
     QRPVQSVYTN VRDLDGLRRS TEAGKRLGFF GRSAIHPAQL PVINEVFTPT EEEVAEAREL       240
     LSRMEGAAAS GSGAFVLEDG RFVDEAVVRA ARFTLAVARG ANGEER                      286
//

If you have problems or comments...

PBIL Back to PBIL home page