(data stored in ACNUC7421 zone)

EMBL: CP000386.PE365

CP000386.PE365       Location/Qualifiers
FT   CDS             complement(396874..397545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0370"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: tfu:Tfu_2799
FT                   TetR/AcrR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03346"
FT                   /db_xref="GOA:Q1AZ32"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ32"
FT                   /protein_id="ABG03346.1"
FT                   /translation="MSGLRRRGIGRPPLSGPEAEANPLSELSFEERRELFLEAAVRLFE
FT                   EKGYKNTSVEDIAGELGFTKKVFYYYWKNKREIVQEIHDRGMALMNAQLDAVLEEEGAP
FT                   DARLDAAIRNHLRTVLRDRSIAGTLLGDFEFSEETLRARREYTRRFQRLVEDGMAAGVV
FT                   RKTDPRMLTFAILGLCNSVGQWYRREGRLTDEEILDIFASFAARGWREGEPAEEQREGG
FT                   G"
     MSGLRRRGIG RPPLSGPEAE ANPLSELSFE ERRELFLEAA VRLFEEKGYK NTSVEDIAGE        60
     LGFTKKVFYY YWKNKREIVQ EIHDRGMALM NAQLDAVLEE EGAPDARLDA AIRNHLRTVL       120
     RDRSIAGTLL GDFEFSEETL RARREYTRRF QRLVEDGMAA GVVRKTDPRM LTFAILGLCN       180
     SVGQWYRREG RLTDEEILDI FASFAARGWR EGEPAEEQRE GGG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page