(data stored in ACNUC7421 zone)

EMBL: CP000386.PE373

CP000386.PE373       Location/Qualifiers
FT   CDS             complement(406295..406999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0378"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver transcriptional
FT                   regulatory protein-like; KEGG: ctc:CTC01130 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03354"
FT                   /db_xref="GOA:Q1AZ24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ24"
FT                   /protein_id="ABG03354.1"
FT                   /translation="MARVLIVEDDPAVRDVVEHTLSREGIETETVPDGETALELLSDSK
FT                   PFDLVLLDVMLPGMDGISVCRELRESHSPHRTVPVVMLTARDDETSIVVGLEVGADDYI
FT                   TKPFSPRQLASRVRAQLRRQRMNAQASPEQRKLEFPGLEIDLLRRRVTARGEQVELTAR
FT                   EFEVLALLASNPGRVYSREQIMDHLWGGEFFGEPRSADVHIQHLRQKIEPDPKNPRYIQ
FT                   TVRGMGYRFAEL"
     MARVLIVEDD PAVRDVVEHT LSREGIETET VPDGETALEL LSDSKPFDLV LLDVMLPGMD        60
     GISVCRELRE SHSPHRTVPV VMLTARDDET SIVVGLEVGA DDYITKPFSP RQLASRVRAQ       120
     LRRQRMNAQA SPEQRKLEFP GLEIDLLRRR VTARGEQVEL TAREFEVLAL LASNPGRVYS       180
     REQIMDHLWG GEFFGEPRSA DVHIQHLRQK IEPDPKNPRY IQTVRGMGYR FAEL             234
//

If you have problems or comments...

PBIL Back to PBIL home page