(data stored in ACNUC7421 zone)

EMBL: CP000386.PE374

CP000386.PE374       Location/Qualifiers
FT   CDS             complement(406992..408716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0379"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase-like histidine
FT                   kinase, HAMP region histidine kinase A-like PAS fold-4 PAS
FT                   fold; SMART: PAS; KEGG: sth:STH3307 two-component sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03355"
FT                   /db_xref="GOA:Q1AZ23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ23"
FT                   /protein_id="ABG03355.1"
FT                   /translation="MLARRPGISSFVAFRFRIWMPVAVILTVLLTVALMFAYGIPAVQT
FT                   RLRDYAQDRTLARAAAIADALSGERRGDWRQTLRASAGEERASVLVVGRDGEVELRVGQ
FT                   PLPEGLPGKVREKAASGERMRLKLGERWLAVVPINRGGELFGGLVLVSGDPGGAVYRIF
FT                   LRAGVEAAAIASVFGGGLALLISTLLTRRVERLAHGARTIERGDLSYRIKPGYRDEFGE
FT                   LAEAFNAMAGRLERSFSRVEEERATLRAVLDNLTEGVLATDLKGRVLFANPAAREMLGL
FT                   DDRDGPQRLPDPWPEFSLPEAVLRCARRERCGEARVRGKDTFLRVRLEHLPHFDDHRGG
FT                   VLVVVQDLSEGLRLEARQQRFLANAAHELKTPITAILGAAELLLTEEEDDPEVRRRFLE
FT                   HIHSEARRMQRLSETLLRLARTGWDHREPDLRPLDPEEAARRAAESMRPLADRDGVSIR
FT                   VEGEGSRAYADPEWLEQALLVLLGNALRHSERGGEIRLRVSGPSITVEDEGEGIRREDL
FT                   PHVFERFYRGRGSRGGFGLGLPICKELVEGMGGRISISSERGVGTAVTVELREVEDG"
     MLARRPGISS FVAFRFRIWM PVAVILTVLL TVALMFAYGI PAVQTRLRDY AQDRTLARAA        60
     AIADALSGER RGDWRQTLRA SAGEERASVL VVGRDGEVEL RVGQPLPEGL PGKVREKAAS       120
     GERMRLKLGE RWLAVVPINR GGELFGGLVL VSGDPGGAVY RIFLRAGVEA AAIASVFGGG       180
     LALLISTLLT RRVERLAHGA RTIERGDLSY RIKPGYRDEF GELAEAFNAM AGRLERSFSR       240
     VEEERATLRA VLDNLTEGVL ATDLKGRVLF ANPAAREMLG LDDRDGPQRL PDPWPEFSLP       300
     EAVLRCARRE RCGEARVRGK DTFLRVRLEH LPHFDDHRGG VLVVVQDLSE GLRLEARQQR       360
     FLANAAHELK TPITAILGAA ELLLTEEEDD PEVRRRFLEH IHSEARRMQR LSETLLRLAR       420
     TGWDHREPDL RPLDPEEAAR RAAESMRPLA DRDGVSIRVE GEGSRAYADP EWLEQALLVL       480
     LGNALRHSER GGEIRLRVSG PSITVEDEGE GIRREDLPHV FERFYRGRGS RGGFGLGLPI       540
     CKELVEGMGG RISISSERGV GTAVTVELRE VEDG                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page