(data stored in ACNUC7421 zone)

EMBL: CP000386.PE379

CP000386.PE379       Location/Qualifiers
FT   CDS             412726..413721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   lmf:LMOf2365_2525 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03360"
FT                   /db_xref="GOA:Q1AZ18"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ18"
FT                   /protein_id="ABG03360.1"
FT                   /translation="MRRSLLGVLLGLALGAVGFAFAAYHVDRPLRIAHLWPVPLAAAVT
FT                   LLCWLIQGSIIALLAWPELRRVRVLQMTRVYLATQAVGGITPFAGGEIAYQLLALKRHG
FT                   LGADVGGAVIALRSALNGVVLLAAAVAGLLVVRRVPFVGGGSSLPFSATTVLLVGVVAL
FT                   SAAWLLLVFLIRRRRGREGGGGGPGLVGRAASYLRHLRDSLLLIWRREPRVIAGCLLLA
FT                   ALYWLLYPLLGTLSLRAAGWDGSGWLAVFAAQYVLFLVIPIAPTPGNGGAAEIAFVALM
FT                   SNYVPQGALLGGVVLWRVLNHFSELVVGAFIAGSEVHEDIELARREFGSG"
     MRRSLLGVLL GLALGAVGFA FAAYHVDRPL RIAHLWPVPL AAAVTLLCWL IQGSIIALLA        60
     WPELRRVRVL QMTRVYLATQ AVGGITPFAG GEIAYQLLAL KRHGLGADVG GAVIALRSAL       120
     NGVVLLAAAV AGLLVVRRVP FVGGGSSLPF SATTVLLVGV VALSAAWLLL VFLIRRRRGR       180
     EGGGGGPGLV GRAASYLRHL RDSLLLIWRR EPRVIAGCLL LAALYWLLYP LLGTLSLRAA       240
     GWDGSGWLAV FAAQYVLFLV IPIAPTPGNG GAAEIAFVAL MSNYVPQGAL LGGVVLWRVL       300
     NHFSELVVGA FIAGSEVHED IELARREFGS G                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page